CIDEC Antibody (2E2) - Azide and BSA Free

Western Blot: CIDEC Antibody (2E2) [H00063924-M07] - Western Blot analysis of CIDEC expression in HeLa ( Cat # L013V1 ).

ELISA: CIDEC Antibody (2E2) [H00063924-M07] - Detection limit for recombinant GST tagged CIDEC is 0.1 ng/ml as a capture antibody.

Western Blot: CIDEC Antibody (2E2) [H00063924-M07] - Total protein levels of proteins involved in lipolysis after prolonged ESA treatment. Western blot analysis of pertinent proteins related to lipolysis in adipose tissue. Biopsies were collected before (black bars) & after 10 weeks (gray bars) of treatment with either placebo or ESA. Data were normalized to total protein level in the gel. Furthermore, the relative increases were measured & the placebo-baseline measurements were set to average 100 %. No effect of ESA treatment or time was found for any of the measured proteins (n = 9) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/27640183), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2E2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CIDEC Antibody (2E2) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse CIDEC Antibody (2E2) - Azide and BSA Free (H00063924-M07) is a monoclonal antibody validated for use in WB and ELISA. Anti-CIDEC Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: CIDEC (NP_071377.2, 53 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVA
• Specificity: CIDEC - cell death-inducing DFFA-like effector c (2E2)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CIDEC
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CIDEC Antibody (2E2) - Azide and BSA Free

• cell death activator CIDE-3
• cell death-inducing DFFA-like effector c
• Cell death-inducing DFFA-like effector protein C
• CIDE-3
• CIDEC
• CIDEX
• Fat-specific protein FSP27 homolog
• FLJ20871
• FSP27
• FSP27fat specific protein 27

Background

DNA fragmentation factor (DFF) induces the fragmentation of DNA associated with apoptosis. A novel family of cell death-inducing DFF45 (MIM 601882)-like effectors (CIDEs), including CIDEC, can also promote apoptosis (Liang et al., 2003 [PubMed 12429024]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CIDEC Antibody (H00063924-M07)(1)

Publication using H00063924-M07

• Christensen B, Nellemann B, Jorgensen JO et al. Erythropoietin does not activate erythropoietin receptor signaling or lipolytic pathways in human subcutaneous white adipose tissue in vivo. Lipids Health Dis 2016-09-17 [PMID: 27640183]

Bioinformatics

• Gene Symbol: CIDEC
• Entrez:
  • 63924(Human)
• Uniprot:
  • NP_071377(Human)