Recombinant Human CIDEB GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CIDEB GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-219 of Human CIDEB full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHSY

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
CIDEB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
49.83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CIDEB GST (N-Term) Protein

  • cell death-inducing DFFA-like effector bcell death activator CIDE-B

Background

Activates apoptosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-430
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-76950
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF4679
Species: Hu
Applications: WB
210-TA
Species: Hu
Applications: BA
NB110-40877
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB120-13592
Species: Hu, Mu
Applications: WB
DFS00
Species: Hu
Applications: ELISA
H00005957-M37
Species: Hu
Applications: ELISA, ICC/IF, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
462-TR/CF
Species: Mu
Applications: BA
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-92503
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92897
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB7047
Species: Hu
Applications: ICC, WB
375-TL
Species: Hu
Applications: BA
H00027141-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for CIDEB Recombinant Protein (H00027141-P01) (0)

There are no publications for CIDEB Recombinant Protein (H00027141-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CIDEB Recombinant Protein (H00027141-P01) (0)

There are no reviews for CIDEB Recombinant Protein (H00027141-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CIDEB Recombinant Protein (H00027141-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CIDEB Products

Bioinformatics Tool for CIDEB Recombinant Protein (H00027141-P01)

Discover related pathways, diseases and genes to CIDEB Recombinant Protein (H00027141-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CIDEB Recombinant Protein (H00027141-P01)

Discover more about diseases related to CIDEB Recombinant Protein (H00027141-P01).
 

Pathways for CIDEB Recombinant Protein (H00027141-P01)

View related products by pathway.

PTMs for CIDEB Recombinant Protein (H00027141-P01)

Learn more about PTMs related to CIDEB Recombinant Protein (H00027141-P01).
 

Research Areas for CIDEB Recombinant Protein (H00027141-P01)

Find related products by research area.

Blogs on CIDEB

There are no specific blogs for CIDEB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CIDEB GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CIDEB