CIB3 Antibody - BSA Free

Immunohistochemistry-Paraffin: CIB3 Antibody [NBP1-91786] - Staining of human rectum shows moderate cytoplasmic and nuclear positivity in glandular cells.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CIB3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FNNDDYICAWDLEQTVTKLTRGGLSAEEVSLVCEKVLDEADG
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CIB3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CIB3 Protein (NBP1-91786PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CIB3 Antibody - BSA Free

• calcium and integrin binding family member 3
• calcium and integrin-binding family member 3
• DNA-dependent protein kinase catalytic subunit-interacting protein 3
• Kinase-interacting protein 3
• KIP 3
• KIP3MGC96922
• MGC138405
• MGC142151

Background

The CIB3 gene product shares a high degree of sequence similarity with DNA-dependent protein kinase catalytic subunit-interacting protein 2 in human and mouse, and like them may bind the catalytic subunit of DNA-dependent protein kinases. The exact function o

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CIB3