Chymotrypsin-like protease Antibody


Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Chymotrypsin-like protease Antibody Summary

Synthetic peptides corresponding to CTRL(chymotrypsin-like) The peptide sequence was selected from the N terminal of CTRL. Peptide sequence LLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CTRL and was validated on Western blot.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Chymotrypsin-like protease Antibody

  • chymotrypsin-like protease CTRL-1
  • chymotrypsin-like
  • CTRL1
  • EC 3.4.21
  • EC 3.4.21.-
  • MGC70821


CTRL contains 1 F-box domain. It is substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.The protein directly interacts with SKP1A and CUL1. A chromosomal aberration involving FBXO25 is a cause of X-linked mental retardation (XLMR).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow

Publications for Chymotrypsin-like protease Antibody (NBP1-58056) (0)

There are no publications for Chymotrypsin-like protease Antibody (NBP1-58056).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chymotrypsin-like protease Antibody (NBP1-58056) (0)

There are no reviews for Chymotrypsin-like protease Antibody (NBP1-58056). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Chymotrypsin-like protease Antibody (NBP1-58056) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Chymotrypsin-like protease Antibody Products

Related Products by Gene

Bioinformatics Tool for Chymotrypsin-like protease Antibody (NBP1-58056)

Discover related pathways, diseases and genes to Chymotrypsin-like protease Antibody (NBP1-58056). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chymotrypsin-like protease Antibody (NBP1-58056)

Discover more about diseases related to Chymotrypsin-like protease Antibody (NBP1-58056).

Pathways for Chymotrypsin-like protease Antibody (NBP1-58056)

View related products by pathway.

PTMs for Chymotrypsin-like protease Antibody (NBP1-58056)

Learn more about PTMs related to Chymotrypsin-like protease Antibody (NBP1-58056).

Blogs on Chymotrypsin-like protease

There are no specific blogs for Chymotrypsin-like protease, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Chymotrypsin-like protease Antibody and receive a gift card or discount.


Gene Symbol CTRL

Customers Who Bought This Also Bought