Chymotrypsin-like protease Antibody

Images

 
Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Chymotrypsin-like protease Antibody Summary

Immunogen
Synthetic peptides corresponding to CTRL(chymotrypsin-like) The peptide sequence was selected from the N terminal of CTRL. Peptide sequence LLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL.
Clonality
Polyclonal
Host
Rabbit
Gene
CTRL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CTRL and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Chymotrypsin-like protease Antibody

  • chymotrypsin-like protease CTRL-1
  • chymotrypsin-like
  • CTRL1
  • EC 3.4.21
  • EC 3.4.21.-
  • MGC70821

Background

CTRL contains 1 F-box domain. It is substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.The protein directly interacts with SKP1A and CUL1. A chromosomal aberration involving FBXO25 is a cause of X-linked mental retardation (XLMR).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32975
Species: Hu, Rt, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB100-1533
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-87296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32001
Species: Hu
Applications: WB, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85010
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow

Publications for Chymotrypsin-like protease Antibody (NBP1-58056) (0)

There are no publications for Chymotrypsin-like protease Antibody (NBP1-58056).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chymotrypsin-like protease Antibody (NBP1-58056) (0)

There are no reviews for Chymotrypsin-like protease Antibody (NBP1-58056). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Chymotrypsin-like protease Antibody (NBP1-58056) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Chymotrypsin-like protease Antibody Products

Related Products by Gene

Bioinformatics Tool for Chymotrypsin-like protease Antibody (NBP1-58056)

Discover related pathways, diseases and genes to Chymotrypsin-like protease Antibody (NBP1-58056). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chymotrypsin-like protease Antibody (NBP1-58056)

Discover more about diseases related to Chymotrypsin-like protease Antibody (NBP1-58056).
 

Pathways for Chymotrypsin-like protease Antibody (NBP1-58056)

View related products by pathway.

PTMs for Chymotrypsin-like protease Antibody (NBP1-58056)

Learn more about PTMs related to Chymotrypsin-like protease Antibody (NBP1-58056).

Blogs on Chymotrypsin-like protease

There are no specific blogs for Chymotrypsin-like protease, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Chymotrypsin-like protease Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTRL
Uniprot

Customers Who Bought This Also Bought