Chymotrypsin-like protease Antibody (NBP1-58056)


Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Chymotrypsin-like protease Antibody Summary

Synthetic peptides corresponding to CTRL(chymotrypsin-like) The peptide sequence was selected from the N terminal of CTRL. Peptide sequence LLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CTRL and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Chymotrypsin-like protease Antibody

  • chymotrypsin-like protease CTRL-1
  • chymotrypsin-like
  • CTRL1
  • EC 3.4.21
  • EC 3.4.21.-
  • MGC70821


CTRL contains 1 F-box domain. It is substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.The protein directly interacts with SKP1A and CUL1. A chromosomal aberration involving FBXO25 is a cause of X-linked mental retardation (XLMR).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Po
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB

Publications for Chymotrypsin-like protease Antibody (NBP1-58056) (0)

There are no publications for Chymotrypsin-like protease Antibody (NBP1-58056).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chymotrypsin-like protease Antibody (NBP1-58056) (0)

There are no reviews for Chymotrypsin-like protease Antibody (NBP1-58056). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Chymotrypsin-like protease Antibody (NBP1-58056) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Chymotrypsin-like protease Antibody Products

Related Products by Gene

Bioinformatics Tool for Chymotrypsin-like protease Antibody (NBP1-58056)

Discover related pathways, diseases and genes to Chymotrypsin-like protease Antibody (NBP1-58056). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chymotrypsin-like protease Antibody (NBP1-58056)

Discover more about diseases related to Chymotrypsin-like protease Antibody (NBP1-58056).

Pathways for Chymotrypsin-like protease Antibody (NBP1-58056)

View related products by pathway.

PTMs for Chymotrypsin-like protease Antibody (NBP1-58056)

Learn more about PTMs related to Chymotrypsin-like protease Antibody (NBP1-58056).

Blogs on Chymotrypsin-like protease

There are no specific blogs for Chymotrypsin-like protease, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Chymotrypsin-like protease Antibody and receive a gift card or discount.


Gene Symbol CTRL

Customers Who Bought This Also Bought