Chordin-like 1/CHRDL1 Antibody

Images

 
Western Blot: Chordin-like 1/CHRDL1 Antibody [NBP1-84486] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: Chordin-like 1/CHRDL1 Antibody [NBP1-84486] - Staining of human parathyroid gland shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Chordin-like 1/CHRDL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EELPGQSFDNKGYFCGEETMPVYESVFMEDGETTRKIALETERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELPHFKLVTRTTLSQWKIFTEGEAQISQMCSSRVCRTEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHRDL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Chordin-like 1/CHRDL1 Protein (NBP1-84486PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Chordin-like 1/CHRDL1 Antibody

  • CHL
  • Chordin-like 1
  • chordin-like protein 1
  • CHRDL1
  • CRDL1
  • dA141H5.1
  • Neuralin 1
  • neuralin-1
  • neurogenesin-1
  • NRLN1
  • NRLN1neuralin 1
  • Ventroptin alpha
  • ventroptin
  • VOPT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-56883
Species: Hu
Applications: IHC, IHC-P
MAB2520
Species: Mu
Applications: WB, IHC, IP
AF5286
Species: Hu
Applications: WB
AF1927
Species: Hu
Applications: WB, IP, ICC
AF2069
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-87508
Species: Hu
Applications: WB, IHC, IHC-P
H00001663-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for Chordin-like 1/CHRDL1 Antibody (NBP1-84486) (0)

There are no publications for Chordin-like 1/CHRDL1 Antibody (NBP1-84486).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chordin-like 1/CHRDL1 Antibody (NBP1-84486) (0)

There are no reviews for Chordin-like 1/CHRDL1 Antibody (NBP1-84486). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Chordin-like 1/CHRDL1 Antibody (NBP1-84486) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Chordin-like 1/CHRDL1 Products

Bioinformatics Tool for Chordin-like 1/CHRDL1 Antibody (NBP1-84486)

Discover related pathways, diseases and genes to Chordin-like 1/CHRDL1 Antibody (NBP1-84486). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chordin-like 1/CHRDL1 Antibody (NBP1-84486)

Discover more about diseases related to Chordin-like 1/CHRDL1 Antibody (NBP1-84486).
 

Pathways for Chordin-like 1/CHRDL1 Antibody (NBP1-84486)

View related products by pathway.

PTMs for Chordin-like 1/CHRDL1 Antibody (NBP1-84486)

Learn more about PTMs related to Chordin-like 1/CHRDL1 Antibody (NBP1-84486).

Blogs on Chordin-like 1/CHRDL1

There are no specific blogs for Chordin-like 1/CHRDL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Chordin-like 1/CHRDL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRDL1
Entrez