Choline Acetyltransferase/ChAT Antibody (CL3173)

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining in human placenta and liver tissues. Corresponding CHAT RNA-seq data are presented ...read more
Immunocytochemistry/ Immunofluorescence: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of SK-MEL-30 cells using the Anti-CHAT monoclonal antibody, showing specific staining in the cytosol in ...read more
Immunohistochemistry: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of rat brain shows strong positivity in acetylcholine neurons in the basal forebrain.
Immunohistochemistry: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of mouse brain shows strong positivity in acetylcholine neurons in the basal forebrain.
Immunohistochemistry: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of mouse basal forebrain shows strong positivity in acetylcholine neurons in the caudate putamen.
Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of human cerebral cortex shows moderate positivity in cholinergic neural fibers.
Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of human placenta shows strong cytoplasmic positivity in a subset of cells in chorionic villi.
Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clone
CL3173
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Choline Acetyltransferase/ChAT Antibody (CL3173) Summary

Immunogen
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTN
Epitope
GLFSSYRLPGHTQDT
Specificity
Specificity of human Choline Acetyltransferase/ChAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG2b
Clonality
Monoclonal
Host
Mouse
Gene
CHAT
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
Publications
Read Publications using
NBP2-46620 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Choline Acetyltransferase/ChAT Antibody (CL3173)

  • acetyl CoA:choline O-acetyltransferase
  • CHAT
  • CHOACTase
  • Choline acetylase
  • Choline Acetyltransferase
  • choline O-acetyltransferase
  • CMS1A
  • CMS1A2
  • EC 2.3.1
  • EC 2.3.1.6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1519
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NB100-91348
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
MAB367
Species: Hu, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-02161
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB100-858
Species: Hu, Mu, Rt, Gp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-50028
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P, IHC-FrFl

Publications for Choline Acetyltransferase/ChAT Antibody (NBP2-46620)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(2)
All Species

Reviews for Choline Acetyltransferase/ChAT Antibody (NBP2-46620) (0)

There are no reviews for Choline Acetyltransferase/ChAT Antibody (NBP2-46620). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Choline Acetyltransferase/ChAT Antibody (NBP2-46620) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Choline Acetyltransferase/ChAT Products

Bioinformatics Tool for Choline Acetyltransferase/ChAT Antibody (NBP2-46620)

Discover related pathways, diseases and genes to Choline Acetyltransferase/ChAT Antibody (NBP2-46620). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Choline Acetyltransferase/ChAT Antibody (NBP2-46620)

Discover more about diseases related to Choline Acetyltransferase/ChAT Antibody (NBP2-46620).
 

Pathways for Choline Acetyltransferase/ChAT Antibody (NBP2-46620)

View related products by pathway.

PTMs for Choline Acetyltransferase/ChAT Antibody (NBP2-46620)

Learn more about PTMs related to Choline Acetyltransferase/ChAT Antibody (NBP2-46620).
 

Research Areas for Choline Acetyltransferase/ChAT Antibody (NBP2-46620)

Find related products by research area.

Blogs on Choline Acetyltransferase/ChAT.

Choline Acetyltransferase (ChAT) – a useful Immunohistochemical marker for morphological studies of neurons
Choline Acetyltransferase (ChAT) is the enzyme that is responsible for biosynthesis of the neurotransmitter acetylcholine. The majority of acetylcholine is synthesized locally at nerve terminals where ChAT catalyzes the transfer of an acetyl group...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Choline Acetyltransferase/ChAT Antibody (CL3173) and receive a gift card or discount.

Bioinformatics

Gene Symbol CHAT
Entrez
Uniprot