![Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining in human placenta and liver tissues. Corresponding CHAT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/Choline-Acetyltransferase-ChAT-Antibody-(CL3173)-Immunohistochemistry-Paraffin-NBP2-46620-img0015.jpg "Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining in human placenta and liver tissues. Corresponding CHAT RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P |
| Clone | CL3173 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTN |
| Epitope | GLFSSYRLPGHTQDT |
| Specificity | Specificity of human Choline Acetyltransferase/ChAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG2b |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CHAT |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Diseases for Choline Acetyltransferase/ChAT Antibody (NBP2-46620)Discover more about diseases related to Choline Acetyltransferase/ChAT Antibody (NBP2-46620).
| Pathways for Choline Acetyltransferase/ChAT Antibody (NBP2-46620)View related products by pathway.
|
|
Choline Acetyltransferase (ChAT) – a useful Immunohistochemical marker for morphological studies of neurons Choline Acetyltransferase (ChAT) is the enzyme that is responsible for biosynthesis of the neurotransmitter acetylcholine. The majority of acetylcholine is synthesized locally at nerve terminals where ChAT catalyzes the transfer of an acetyl group... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of SK-MEL-30 cells using the Anti-CHAT monoclonal antibody, showing specific staining in the cytosol in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/Choline-Acetyltransferase-ChAT-Antibody-(CL3173)-Immunocytochemistry-Immunofluorescence-NBP2-46620-img0021.jpg "Immunocytochemistry/Immunofluorescence: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of SK-MEL-30 cells using the Anti-CHAT monoclonal antibody, showing specific staining in the cytosol in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.")
![Immunohistochemistry: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of rat brain shows strong positivity in acetylcholine neurons in the basal forebrain.](http://images.novusbio.com/fullsize2/Choline-Acetyltransferase-ChAT-Antibody-(CL3173)-Immunohistochemistry-NBP2-46620-img0016.jpg "Immunohistochemistry: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of rat brain shows strong positivity in acetylcholine neurons in the basal forebrain.")
![Immunohistochemistry: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of mouse brain shows strong positivity in acetylcholine neurons in the basal forebrain.](http://images.novusbio.com/fullsize2/Choline-Acetyltransferase-ChAT-Antibody-(CL3173)-Immunohistochemistry-NBP2-46620-img0010.jpg "Immunohistochemistry: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of mouse brain shows strong positivity in acetylcholine neurons in the basal forebrain.")
![Immunohistochemistry: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of mouse basal forebrain shows strong positivity in acetylcholine neurons in the caudate putamen.](http://images.novusbio.com/fullsize2/Choline-Acetyltransferase-ChAT-Antibody-(CL3173)-Immunohistochemistry-NBP2-46620-img0011.jpg "Immunohistochemistry: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of mouse basal forebrain shows strong positivity in acetylcholine neurons in the caudate putamen.")
![Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of human cerebral cortex shows moderate positivity in cholinergic neural fibers.](http://images.novusbio.com/fullsize2/Choline-Acetyltransferase-ChAT-Antibody-(CL3173)-Immunohistochemistry-Paraffin-NBP2-46620-img0012.jpg "Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of human cerebral cortex shows moderate positivity in cholinergic neural fibers.")
![Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of human placenta shows strong cytoplasmic positivity in a subset of cells in chorionic villi.](http://images.novusbio.com/fullsize2/Choline-Acetyltransferase-ChAT-Antibody-(CL3173)-Immunohistochemistry-Paraffin-NBP2-46620-img0013.jpg "Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of human placenta shows strong cytoplasmic positivity in a subset of cells in chorionic villi.")
![Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize2/Choline-Acetyltransferase-ChAT-Antibody-(CL3173)-Immunohistochemistry-Paraffin-NBP2-46620-img0014.jpg "Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody (CL3173) [NBP2-46620] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Staining of HepG2 (A) and Daudi cell lysates with antibody at 1 ug/mL (B) and HeLa (C) and Jurkat (D) cell lysates with antibody at 0.3 ug/mL (35 ug protein in RIPA buffer). Detected by chemiluminescence.](http://images.novusbio.com/images2/Acetylcholinesterase-ACHE-Antibody-Western-Blot-NB100-1519-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Immunofluorescence analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (4 ug/mL), showing cytoplasmic and nuclear/Vesicle staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (4 ug/mL).](http://images.novusbio.com/images2/Acetylcholinesterase-ACHE-Antibody-Immunocytochemistry-Immunofluorescence-NB100-1519-img0002.jpg)
![Flow Cytometry: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Flow cytometric analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.](http://images.novusbio.com/images2/Acetylcholinesterase-ACHE-Antibody-Flow-Cytometry-NB100-1519-img0003.jpg)
![Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the central complex and the lateral accessory lobe. A-D: Frontal sections (immunoperoxidase preparations, dorsal to the top). E: Horizontal section (immunofluorescent preparation, posterior to the top). Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Tyrosine-Hydroxylase-Antibody-Immunohistochemistry-NB300-109-img0029.jpg)
![Immunocytochemistry/Immunofluorescence: Tyrosine Hydroxylase Antibody [NB300-109] - Dopamine neurons in the mouse substantia nigra. ICC/IF image submitted by a verified customer review.](http://images.novusbio.com/images2/Tyrosine-Hydroxylase-Antibody-Immunocytochemistry-Immunofluorescence-NB300-109-img0007.jpg)
![Simple Western: Tyrosine Hydroxylase Antibody [NB300-109] - Simple Western lane view shows a specific band for Tyrosine Hydroxylase in 0.2 mg/mL of PC-12 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/images2/Tyrosine-Hydroxylase-Antibody-Simple-Western-NB300-109-img0008.jpg)
![Western Blot: Glutamine Synthetase Antibody [NB110-41404] - Analysis of glutamine synthase. 40ug of lysates from mouse (Lanes M), rat (Lane R), pig (Lane P), bovine (Lane B), or human (Lane Hu) retina were probed. A 42 kDa band was identified in lysates from retinas of all species.](http://images.novusbio.com/images2/Glutamine Synthetase Antibody-Western Blot-NB110-41404-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: Glutamine Synthetase Antibody [NB110-41404] - Immunofluorescence using NB110-41404. Submitted via verified customer review.](http://images.novusbio.com/images2/Glutamine-Synthetase-Antibody-Immunocytochemistry-Immunofluorescence-NB110-41404-img0006.jpg)
![Immunohistochemistry: Glutamine Synthetase Antibody [NB110-41404] - Localization of glutamine synthase in the retina. Paraffin sections of mouse (A, B), rat (C, D, G-I), or human (E, F) retina fixed in 4% paraformaldehyde were reacted with anti-glutamine synthase (red fluorescence staining in B, D, G, I, and brown immuno-peroxidase reaction. Nuclei in IF experiments (A-D) were stained with DAPI (cyan), and with nuclear fast red in E and F. At low magnification, anti-glutamine synthase reacted with a single population of cells extending from the ganglion cell layer through the inner nuclear layer. No signal was detected in controls either pre-incubated with 100ug/ml of the immunizing peptide (A) or with pre-immune serum (C, E). This finding was confirmed by co-localization (indicated by yellow in I) of glutamine synthase (red in G) with antoher marker of glutamine synthase (green in H).](http://images.novusbio.com/images2/Glutamine Synthetase Antibody-Immunohistochemistry-NB110-41404-img0002.jpg)
![Western Blot: VAChT/SLC18A3 Antibody [NB100-91348] - Rat and mouse tissue lysates. Blocking: 1% LFDM for 30 min at RT; primary antibody: dilution 1:2000 incubated at 4C overnight.](http://images.novusbio.com/images2/VAChT-SLC18A3-Antibody-Western-Blot-NB100-91348-img0032.jpg)
![Immunohistochemistry-Paraffin: VAChT/SLC18A3 Antibody [NB100-91348] - Rat spinal cord. The animal was perfused at a pressure of 130 mmHg with 300 ml 4% FA before being processed for paraffin embedding. HIER: Tris-EDTA, pH 9 for 20 min. Blocking: 0.2% LFDM in TBST filtered thru 0.2 um.](http://images.novusbio.com/images2/VAChT-SLC18A3-Antibody-Immunohistochemistry-Paraffin-NB100-91348-img0031.jpg)
![Immunohistochemistry-Paraffin: VAChT/SLC18A3 Antibody [NB100-91348] - IHC on rat spinal cord (paraffin section) using Rabbit antibody to (Vesicular Acetylcholine Transporter) VACHT: whole serum at 1 : 200 dilution incubated overnight at 4C, developed with DAB/Ni and counterstained with hematoxylin.](http://images.novusbio.com/images2/VAChT-SLC18A3-Antibody-Immunohistochemistry-Paraffin-NB100-91348-img0015.jpg)
![Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Analysis in human testis and lymph node tissues. Corresponding CRAT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/CRAT-Antibody-Immunohistochemistry-Paraffin-NBP1-86616-img0014.jpg)
![Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).](http://images.novusbio.com/images2/CRAT-Antibody-Western-Blot-NBP1-86616-img0011.jpg)
![Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.](http://images.novusbio.com/images2/CRAT-Antibody-Western-Blot-NBP1-86616-img0010.jpg)
![Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.](http://images.novusbio.com/images2/Catalase-Antibody-Western-Blot-NBP2-24916-img0001.jpg)
![Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.](http://images.novusbio.com/images2/Catalase-Antibody-Immunohistochemistry-Paraffin-NBP2-24916-img0002.jpg)
![Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.](http://images.novusbio.com/images2/GLYAT-Antibody-Western-Blot-NBP2-58917-img0002.jpg)
![Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human skeletal muscle.](http://images.novusbio.com/images2/GLYAT Antibody-Immunohistochemistry-Paraffin-NBP2-58917-img0010.jpg)
![Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.](http://images.novusbio.com/images2/GLYAT-Antibody-Immunohistochemistry-Paraffin-NBP2-58917-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: Substance P Antibody [NB300-187] - Staining of trigeminal ganglia from P3-P5 rat pups. BMC Neuroscience 2010, 11:32doi:10.1186/1471-2202-11-32](http://images.novusbio.com/images2/Substance-P-Antibody-Immunocytochemistry-Immunofluorescence-NB300-187-img0005.jpg)
![Immunohistochemistry: Substance P Antibody [NB300-187] - Spinal Cord Dorsal Horn (Human).](http://images.novusbio.com/images2/Substance P Antibody-Immunohistochemistry-NB300-187-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Substance P Antibody [NB300-187] - Detection of Substance P in rat spinal cord dorsal horn (red fluorescence). DAPI (blue) was used as counter stain.](http://images.novusbio.com/images2/Substance P Antibody-Immunocytochemistry-Immunofluorescence-NB300-187-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: GAD1/GAD67 Antibody [NBP1-02161] - Immunocytochemical staining of GAD1/GAD67 (RED/YELLOW) in cultured cortical neurons from a neonatal mouse (C57/Black6). GAD1/GAD67 staining was detected using Texas Red goat anti-chicken IgY. MAP2 staining (GREEN) used a rabbit antibody.](http://images.novusbio.com/images2/GAD1-GAD67-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-02161-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: GAD1/GAD67 Antibody [NBP1-02161] - Sph21 neuroblastoma cells in culture. Fixed with 4% paraformaldehyde. GAD1/GAD67 (GREEN) immunoreactivity. Phalloidin (F-actin) (RED) staining. DAPI (BLUE) staining.](http://images.novusbio.com/images2/GAD1-GAD67-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-02161-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: GAD1/GAD67 Antibody [NBP1-02161] - Immunohistochemical staining of inhibitory neurons (RED) within the hippocampal formation of a transgenic, adult male Black6 mouse brain. The brains were fixed with 4.0% paraformaldehyde. The green staining is low level GFP fluorescence expressed off the actin promoter in this mouse transgenic strain.](http://images.novusbio.com/images2/GAD1-GAD67-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-02161-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: VIP Antibody (2) [NBP1-05163] - Staining in human pancreas tissue. Signal is strong in nerves of exocrine part of pancreas. Dilution: 1:100.](http://images.novusbio.com/images2/VIP-Antibody-(2)-Immunocytochemistry-Immunofluorescence-NBP1-05163-img0005.jpg)
![Immunohistochemistry-Paraffin: VIP Antibody (2) - BSA Free [NBP1-05163] - Formalin fixed paraffin-embedded human pancreas tissue. Dilution: 1:100](http://images.novusbio.com/images2/VIP-Antibody-(2)----BSA-Free-Immunohistochemistry-Paraffin-NBP1-05163-img0006.jpg)
![Immunohistochemistry-Paraffin: VIP Antibody (2) [NBP1-05163] - Staining of human appendix tissue. Dilution: 1:100](http://images.novusbio.com/images2/VIP-Antibody-(2)-Immunohistochemistry-Paraffin-NBP1-05163-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: nNOS Antibody [NB100-858] - Immunofluorescence analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).](http://images.novusbio.com/images2/nNOS-Antibody-Immunocytochemistry-Immunofluorescence-NB100-858-img0002.jpg)
![Immunohistochemistry-Frozen: nNOS Antibody [NB100-858] - Immunostaining of NOS1 neurons in cryosection of a perfusion-fixed (4% PFA) mouse hypothalamus. HRP-staining with Ni-DAB, after Biotin-SP-anti-goat (IgG) method. Data obtained by Drs. Eva Rumpler and Erik Hrabovszky, Inst, Exp, Med, Budapest, Hungary.](http://images.novusbio.com/images2/nNOS-Antibody-Immunohistochemistry-Frozen-NB100-858-img0004.jpg)
![Flow Cytometry: nNOS Antibody [NB100-858] - Flow cytometric analysis of paraformaldehyde fixed Kelly cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.](http://images.novusbio.com/images2/nNOS-Antibody-Flow-Cytometry-NB100-858-img0003.jpg)
![Western Blot: Somatostatin Antibody (7G5) [NBP2-37447] - Analysis using SST mAb against human SST recombinant protein. (Expected MW is 38.2 kDa)](http://images.novusbio.com/images2/Somatostatin-Antibody-(7G5)-Western-Blot-NBP2-37447-img0002.jpg)
![Immunohistochemistry-Paraffin: Somatostatin Antibody (7G5) [NBP2-37447] - Analysis of lung cancer tissues using SST mouse mAb with DAB staining.](http://images.novusbio.com/images2/Somatostatin-Antibody-(7G5)-Immunohistochemistry-Paraffin-NBP2-37447-img0007.jpg)
![Flow Cytometry: Somatostatin Antibody (7G5) [NBP2-37447] - Analysis of HepG2 cells using SST mouse mAb (green) and negative control (red).](http://images.novusbio.com/images2/Somatostatin-Antibody-(7G5)-Flow-Cytometry-NBP2-37447-img0003.jpg)
![Western Blot: Calbindin D-28K Antibody [NBP2-50028] - Analysis of different tissue lysates and recombinant protein solutions using chicken pAb to calbindin, NBP2-50028, dilution 1:5,000 in green: [1] protein standard (red), [2] rat cerebellum, [3] pig hippocampus, [4] cow cerebellum, [5] protein standard (red). Next lanes are full length recombinant human proteins, [6] Parvalbumin, [7] Calretinin, [8] Calbindin. Bands at 25kDa in tissue lysates and ~30 kDa in protein solutions correspond to calbindin, the recombinant form being slightly larger due to the presence of a His tag and other vector derived sequence. NBP2-50028 antibody specifically recognizes calbindin protein and does not react with the closely related proteins parvalbumin and calretinin.](http://images.novusbio.com/images2/Calbindin-D-28K-Antibody-Western-Blot-NBP2-50028-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: Calbindin D-28K Antibody [NBP2-50028] - Cultured mouse embryonic kidney stained with Calbindin antibody (1:200) and DAPI. Image from verified customer review.](http://images.novusbio.com/images2/Calbindin-D-28K-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-50028-img0005.jpg)
![Immunohistochemistry Free-Floating: Calbindin D-28K Antibody [NBP2-50028] - Analysis of rat cerebellum section stained with chicken Calbindin D-28K pAb, dilution 1:2,000 (Green), and costained with rabbit MeCP2 pAb, dilution 1:5,000 (Red). Following transcardial perfusion with 4% paraformaldehyde, brain was post fixed for 24 hours, cut to 45uM, and free-floating sections were stained with above antibodies. Calbindin D-28K, often used as a Purkinje cell marker, is prominently detected in dendrites and perikarya of these cells in the cerebellar molecular layer. The MeCP2 antibody selectively stains nuclei of neuronal cells.](http://images.novusbio.com/images2/Calbindin-D-28K-Antibody-Immunohistochemistry-Free-Floating-NBP2-50028-img0006.jpg)
