Chitobiase/CTBS Antibody

Images

 
Western Blot: Chitobiase/CTBS Antibody [H00001486-D01P] - Analysis of CTBS expression in human liver.
Western Blot: Chitobiase/CTBS Antibody [H00001486-D01P] - Analysis of CTBS expression in transfected 293T cell line by CTBS polyclonal antibody.Lane 1: CTBS transfected lysate(43.80 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Chitobiase/CTBS Antibody Summary

Immunogen
CTBS (NP_004379.1, 1 a.a. - 385 a.a.) full-length human protein. MSRPQLRRWRLVSSPPSGVPGLALLALLALLALRLAAGTDCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGDVSLKDIIDPAFRASWIAQKLNLAKTQYMDGINIDIEQEVNCLSPEYDALTALVKETTDSFHREIEGSQVTFDVAWSPKNIDRRCYNYTGIADACDFLFVMSYDEQSQIWSECIAAANAPYNQTLTGYNDYIKMSINPKKLVMGVPWYGYDYTCLNLSEDHVCTIAKVPFRGAPCSDAAGRQVPYKTIMKQINSSISGNLWDKDQRAPYYNYKDPAGHFHQVWYDNPQSISLKATYIQNYRLRGIGMWNANCLDYSGDAVAKQQTEEMWEVLKPKLLQR
Specificity
CTBS - chitobiase, di-N-acetyl-,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTBS
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against tissue lysate and transfected lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Chitobiase/CTBS Antibody

  • Chitobiase
  • chitobiase, di-N-acetyl-
  • CTBdi-N-acetylchitobiase
  • CTBS
  • EC 3.2.1.-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-30036
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-59934
Species: Hu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00001486-D01P
Species: Hu
Applications: WB

Publications for Chitobiase/CTBS Antibody (H00001486-D01P) (0)

There are no publications for Chitobiase/CTBS Antibody (H00001486-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chitobiase/CTBS Antibody (H00001486-D01P) (0)

There are no reviews for Chitobiase/CTBS Antibody (H00001486-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Chitobiase/CTBS Antibody (H00001486-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Chitobiase/CTBS Products

Bioinformatics Tool for Chitobiase/CTBS Antibody (H00001486-D01P)

Discover related pathways, diseases and genes to Chitobiase/CTBS Antibody (H00001486-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chitobiase/CTBS Antibody (H00001486-D01P)

Discover more about diseases related to Chitobiase/CTBS Antibody (H00001486-D01P).
 

Pathways for Chitobiase/CTBS Antibody (H00001486-D01P)

View related products by pathway.

Blogs on Chitobiase/CTBS

There are no specific blogs for Chitobiase/CTBS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Chitobiase/CTBS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTBS
Entrez
Uniprot