CHIP/STUB1 Antibody - BSA Free

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510] - Staining of human adrenal gland, colon, gallbladder and kidney using Anti-STUB1 antibody NBP2-47510 (A) shows similar protein distribution across tissues to independent antibody NBP2-47509 (B).

Western Blot: CHIP/STUB1 Antibody [NBP2-47510] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human Analysis of tonsil tissue.

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510] - Staining of human gallbladder.

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510] - Staining of human kidney.

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510] - Staining of human colon.

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510] - Staining of human adrenal gland.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CHIP/STUB1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STUB1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CHIP/STUB1 Protein (NBP2-47510PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CHIP/STUB1 Antibody - BSA Free

• Antigen NY-CO-7
• Carboxy terminus of Hsp70-interacting protein
• CHIP
• CHIPSTIP1 homology and U box-containing protein 1
• CLL-associated antigen KW-8
• E3 ubiquitin-protein ligase CHIP
• EC 6.3.2.-
• heat shock protein A binding protein 2 (c-terminal)
• HSPABP2
• NY-CO-7
• SDCCAG7
• serologically defined colon cancer antigen 7
• STIP1 homology and U-box containing protein 1
• STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase
• STUB1
• UBOX1

Background

STUB1/CHIP is an E3 ubiquitin ligase and co-chaperone of heat-shock protein 70 (Hsp70). STUB1/CHIP interacts with Hsp70 to monitor protein folding and direct misfolded proteins for proteasomal degradation. It has been found to also associate with Hsp90 to remove phosphorylated protein tau, a protein that accumulates in the brains of Alzheimers and Down's syndrome patients. STUB1/CHIP has been reported to also have intrinsic chaperone activity and recognize non-native proteins in response to heat stress. In this way, STUB1/CHIP has been shown to be a direct chaperone for p53. Alternate names for STUB1/CHIP include carboxy terminus of Hsp70-interacting protein, STIP1 homology and U-box containing protein 1, CLL-associated antigen KW-8 antigen, serologically defined colon cancer antigen 7, heat shock protein A binding protein 2, NY-CO-7, HSPABP2, and SDCCAG7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STUB1