CHIP/STUB1 Antibody

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510] - Staining of human adrenal gland, colon, gallbladder and kidney using Anti-STUB1 antibody NBP2-47510 (A) shows similar ...read more
Western Blot: CHIP/STUB1 Antibody [NBP2-47510] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510] - Staining of human gallbladder.
Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510] - Staining of human kidney.
Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510] - Staining of human colon.
Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510] - Staining of human adrenal gland.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

CHIP/STUB1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: CGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STUB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CHIP/STUB1 Protein (NBP2-47510PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHIP/STUB1 Antibody

  • Antigen NY-CO-7
  • Carboxy terminus of Hsp70-interacting protein
  • CHIP
  • CHIPSTIP1 homology and U box-containing protein 1
  • CLL-associated antigen KW-8
  • E3 ubiquitin-protein ligase CHIP
  • EC 6.3.2.-
  • heat shock protein A binding protein 2 (c-terminal)
  • HSPABP2
  • NY-CO-7
  • SDCCAG7
  • serologically defined colon cancer antigen 7
  • STIP1 homology and U-box containing protein 1
  • STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase
  • STUB1
  • UBOX1

Background

STUB1/CHIP is an E3 ubiquitin ligase and co-chaperone of heat-shock protein 70 (Hsp70). STUB1/CHIP interacts with Hsp70 to monitor protein folding and direct misfolded proteins for proteasomal degradation. It has been found to also associate with Hsp90 to remove phosphorylated protein tau, a protein that accumulates in the brains of Alzheimers and Down's syndrome patients. STUB1/CHIP has been reported to also have intrinsic chaperone activity and recognize non-native proteins in response to heat stress. In this way, STUB1/CHIP has been shown to be a direct chaperone for p53. Alternate names for STUB1/CHIP include carboxy terminus of Hsp70-interacting protein, STIP1 homology and U-box containing protein 1, CLL-associated antigen KW-8 antigen, serologically defined colon cancer antigen 7, heat shock protein A binding protein 2, NY-CO-7, HSPABP2, and SDCCAG7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CHIP/STUB1 Antibody (NBP2-47510) (0)

There are no publications for CHIP/STUB1 Antibody (NBP2-47510).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHIP/STUB1 Antibody (NBP2-47510) (0)

There are no reviews for CHIP/STUB1 Antibody (NBP2-47510). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHIP/STUB1 Antibody (NBP2-47510) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHIP/STUB1 Products

Research Areas for CHIP/STUB1 Antibody (NBP2-47510)

Find related products by research area.

Blogs on CHIP/STUB1

There are no specific blogs for CHIP/STUB1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHIP/STUB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STUB1