CHIP/STUB1 Antibody


Immunocytochemistry/ Immunofluorescence: CHIP/STUB1 Antibody [NBP2-47509] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & cytosol.
Immunohistochemistry: CHIP/STUB1 Antibody [NBP2-47509] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

CHIP/STUB1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQ
Specificity of human CHIP/STUB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CHIP/STUB1 Protein (NBP2-47509PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CHIP/STUB1 Antibody

  • Antigen NY-CO-7
  • Carboxy terminus of Hsp70-interacting protein
  • CHIP
  • CHIPSTIP1 homology and U box-containing protein 1
  • CLL-associated antigen KW-8
  • E3 ubiquitin-protein ligase CHIP
  • EC 6.3.2.-
  • heat shock protein A binding protein 2 (c-terminal)
  • NY-CO-7
  • serologically defined colon cancer antigen 7
  • STIP1 homology and U-box containing protein 1
  • STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase
  • STUB1
  • UBOX1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Rb, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Pm
Applications: WB, IHC, IHC-P

Publications for CHIP/STUB1 Antibody (NBP2-47509) (0)

There are no publications for CHIP/STUB1 Antibody (NBP2-47509).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHIP/STUB1 Antibody (NBP2-47509) (0)

There are no reviews for CHIP/STUB1 Antibody (NBP2-47509). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CHIP/STUB1 Antibody (NBP2-47509) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CHIP/STUB1 Antibody (NBP2-47509)

Discover related pathways, diseases and genes to CHIP/STUB1 Antibody (NBP2-47509). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHIP/STUB1 Antibody (NBP2-47509)

Discover more about diseases related to CHIP/STUB1 Antibody (NBP2-47509).

Pathways for CHIP/STUB1 Antibody (NBP2-47509)

View related products by pathway.

PTMs for CHIP/STUB1 Antibody (NBP2-47509)

Learn more about PTMs related to CHIP/STUB1 Antibody (NBP2-47509).

Research Areas for CHIP/STUB1 Antibody (NBP2-47509)

Find related products by research area.

Blogs on CHIP/STUB1

There are no specific blogs for CHIP/STUB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CHIP/STUB1 Antibody and receive a gift card or discount.


Gene Symbol STUB1