CHD9 Antibody - BSA Free Summary
Description |
Novus Biologicals Rabbit CHD9 Antibody - BSA Free (NBP2-48758) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: HQVESQTEPFTGLDPEDLLQEGLLPHFDESTFGQDNSSHILDHDLDRQFTSHLVTRPSDMAQTQLQSQARSWHSSFSNHQHLHDRNHLCLQRQPPSSKKSDGSGTYTKLQNTQV |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CHD9 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for CHD9 Antibody - BSA Free
Background
CHD9/CReMM is a member of the CHD (chromodomain-helicase-DNA-binding) family of proteins that interacts with nucleosomes and plays a role in chromatin remodeling to modulate transcription. The members of the CHD family of proteins possess 3 common structural and functional domains: a chromodomain (chromatin organization modifier), an SNF2-like helicase/ATPase domain, and a C-terminal DNA-binding domain. CHD9/CReMM is thought to play a role in development due to its role in tissue-specific gene transcription. CHD9/CReMM also functions as a PPARA transcriptional coactivator. Alternate names for CHD9/CreMM include chromodomain-helicase-DNA-binding protein 9, ATP-dependent helicase CHD9, chromatin-related mesenchymal modulator, chromatin-remodeling factor CHROM1, PPARA-interacting complex 320 kDa protein, kismet homolog 2, KIAA0308, KISH2, AD013, and PRIC320.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ICC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: Neut, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Av, Bv, Sh
Applications: WB
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ChIP, CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IP, KO, WB
Species: Hu
Applications: IHC
Publications for CHD9 Antibody (NBP2-48758) (0)
There are no publications for CHD9 Antibody (NBP2-48758).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CHD9 Antibody (NBP2-48758) (0)
There are no reviews for CHD9 Antibody (NBP2-48758).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for CHD9 Antibody (NBP2-48758) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CHD9 Products
Blogs on CHD9