CHCHD4 Antibody

Images

 
Immunohistochemistry-Paraffin: CHCHD4 Antibody [NBP1-83537] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHCHD4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHCHD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CHCHD4 Protein (NBP1-83537PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHCHD4 Antibody

  • CHDH4
  • coiled-coil-helix-coiled-coil-helix domain containing 4
  • Coiled-coil-helix-coiled-coil-helix domain-containing protein 4
  • FLJ31709
  • MIA40mitochondrial intermembrane space import and assembly protein 40
  • mitochondrial intermembrane space import and assembly 40 homolog
  • TIMM40
  • translocase of inner mitochondrial membrane 40 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90187
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB2476
Species: Hu
Applications: WB, IHC
NBP1-80682
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00026520-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-30388
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-40853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-76701
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-23000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2050
Species: Hu
Applications: WB, IHC
NBP1-89123
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-94125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83537
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for CHCHD4 Antibody (NBP1-83537) (0)

There are no publications for CHCHD4 Antibody (NBP1-83537).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHCHD4 Antibody (NBP1-83537) (0)

There are no reviews for CHCHD4 Antibody (NBP1-83537). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CHCHD4 Antibody (NBP1-83537) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHCHD4 Products

Bioinformatics Tool for CHCHD4 Antibody (NBP1-83537)

Discover related pathways, diseases and genes to CHCHD4 Antibody (NBP1-83537). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHCHD4 Antibody (NBP1-83537)

Discover more about diseases related to CHCHD4 Antibody (NBP1-83537).
 

Pathways for CHCHD4 Antibody (NBP1-83537)

View related products by pathway.

Blogs on CHCHD4

There are no specific blogs for CHCHD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHCHD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHCHD4