CHCHD4 Antibody - BSA Free

Immunohistochemistry-Paraffin: CHCHD4 Antibody [NBP1-83537] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CHCHD4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CHCHD4 Antibody - BSA Free (NBP1-83537) is a polyclonal antibody validated for use in IHC. Anti-CHCHD4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDL
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHCHD4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CHCHD4 Protein (NBP1-83537PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CHCHD4 Antibody - BSA Free

• CHDH4
• coiled-coil-helix-coiled-coil-helix domain containing 4
• Coiled-coil-helix-coiled-coil-helix domain-containing protein 4
• FLJ31709
• MIA40mitochondrial intermembrane space import and assembly protein 40
• mitochondrial intermembrane space import and assembly 40 homolog
• TIMM40
• translocase of inner mitochondrial membrane 40 homolog

Background

CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005 [PubMed 16185709]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CHCHD4 Antibody (NBP1-83537)(1)

Publication using NBP1-83537

• Ma, J;Wang, PY;Zhuang, J;Son, AY;Karius, AK;Syed, AM;Nishi, M;Wu, Z;Mori, MP;Kim, YC;Hwang, PM; CHCHD4-TRIAP1 regulation of innate immune signaling mediates skeletal muscle adaptation to exercise Cell reports 2023-12-28 [PMID: 38157298]

Bioinformatics

• Gene Symbol: CHCHD4