TIMM9 Antibody (1D6)

Images

 
Western Blot: TIMM9 Antibody (1D6) [H00026520-M01] - TIMM9 monoclonal antibody (M01), clone 1D6. Analysis of TIMM9 expression in NIH/3T3.
Immunohistochemistry-Paraffin: TIMM9 Antibody (1D6) [H00026520-M01] - Analysis of monoclonal antibody to TIMM9 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Western Blot: TIMM9 Antibody (1D6) [H00026520-M01] - TIMM9 monoclonal antibody (M01), clone 1D6. Analysis of TIMM9 expression in PC-12.
Western Blot: TIMM9 Antibody (1D6) [H00026520-M01] - TIMM9 monoclonal antibody (M01), clone 1D6 Analysis of TIMM9 expression in IMR-32.
Western Blot: TIMM9 Antibody (1D6) [H00026520-M01] - TIMM9 monoclonal antibody (M01), clone 1D6. Analysis of TIMM9 expression in Raw 264.7.
Western Blot: TIMM9 Antibody (1D6) [H00026520-M01] - Analysis of TIMM9 expression in transfected 293T cell line by TIMM9 monoclonal antibody (M01), clone 1D6.Lane 1: TIMM9 transfected lysate(10.4 KDa).Lane 2: ...read more
Sandwich ELISA: TIMM9 Antibody (1D6) [H00026520-M01] - Detection limit for recombinant GST tagged TIMM9 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
1D6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TIMM9 Antibody (1D6) Summary

Immunogen
TIMM9 (AAH20213, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
Localization
Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side.
Marker
Mitochondrial Biogenesis Marker
Specificity
TIMM9 - translocase of inner mitochondrial membrane 9 homolog (yeast)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TIMM9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Publications
Read Publication using H00026520-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIMM9 Antibody (1D6)

  • TIM9Amitochondrial import inner membrane translocase subunit Tim9
  • TIM9TIMM9A
  • translocase of inner mitochondrial membrane 9 (yeast) homolog
  • translocase of inner mitochondrial membrane 9 homolog (yeast)

Background

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80682
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-40853
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-76701
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KD
NBP1-31470
Species: Hu, Mu, Rt, Bv, V-Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-23000
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-92509
Species: Hu
Applications: WB, IHC, IHC-P
H00001678-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-13431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-99532
Species: Mu
Applications: IHC, IHC-P
H00006901-M12
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81556
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-86941
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
MAB7940
Species: Hu
Applications: WB, IHC
H00026520-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA

Publications for TIMM9 Antibody (H00026520-M01)(1)

Reviews for TIMM9 Antibody (H00026520-M01) (0)

There are no reviews for TIMM9 Antibody (H00026520-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIMM9 Antibody (H00026520-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TIMM9 Products

Bioinformatics Tool for TIMM9 Antibody (H00026520-M01)

Discover related pathways, diseases and genes to TIMM9 Antibody (H00026520-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TIMM9

There are no specific blogs for TIMM9, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIMM9 Antibody (1D6) and receive a gift card or discount.

Bioinformatics

Gene Symbol TIMM9
Entrez
OMIM
Uniprot