TIMM9 Antibody (1D6) - Azide and BSA Free

Western Blot: TIMM9 Antibody (1D6) [H00026520-M01] - TIMM9 monoclonal antibody (M01), clone 1D6. Analysis of TIMM9 expression in NIH/3T3.

Immunohistochemistry-Paraffin: TIMM9 Antibody (1D6) [H00026520-M01] - Analysis of monoclonal antibody to TIMM9 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.

Western Blot: TIMM9 Antibody (1D6) [H00026520-M01] - TIMM9 monoclonal antibody (M01), clone 1D6. Analysis of TIMM9 expression in PC-12.

Western Blot: TIMM9 Antibody (1D6) [H00026520-M01] - TIMM9 monoclonal antibody (M01), clone 1D6 Analysis of TIMM9 expression in IMR-32.

Western Blot: TIMM9 Antibody (1D6) [H00026520-M01] - TIMM9 monoclonal antibody (M01), clone 1D6. Analysis of TIMM9 expression in Raw 264.7.

Western Blot: TIMM9 Antibody (1D6) [H00026520-M01] - Analysis of TIMM9 expression in transfected 293T cell line by TIMM9 monoclonal antibody (M01), clone 1D6.Lane 1: TIMM9 transfected lysate(10.4 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: TIMM9 Antibody (1D6) [H00026520-M01] - Detection limit for recombinant GST tagged TIMM9 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clone: 1D6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TIMM9 Antibody (1D6) - Azide and BSA Free Summary

• Immunogen: TIMM9 (AAH20213, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
• Localization: Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side.
• Marker: Mitochondrial Biogenesis Marker
• Specificity: TIMM9 - translocase of inner mitochondrial membrane 9 homolog (yeast)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TIMM9
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIMM9 Antibody (1D6) - Azide and BSA Free

• TIM9Amitochondrial import inner membrane translocase subunit Tim9
• TIM9TIMM9A
• translocase of inner mitochondrial membrane 9 (yeast) homolog
• translocase of inner mitochondrial membrane 9 homolog (yeast)

Background

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TIMM9 Antibody (H00026520-M01)(1)

Publication using H00026520-M01

• Lin CC, Fang CL, Sun DP et al. High expression of mitochondrial intermembrane chaperone TIMM9 represents a negative prognostic marker in gastric cancer. J Formos Med Assoc 2016-10-06 [PMID: 27720672]

Review for TIMM9 Antibody (H00026520-M01) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 09/24/2023

Summary

• Application: Western Blot
• Sample Tested: Human Glioma cells, whole cell lysates
• Species: Human
• Lot: EC041-1D6

Bioinformatics

• Gene Symbol: TIMM9
• Entrez:
  • 26520(Human)
• OMIM:
  • 607384(Human)
• Uniprot:
  • AAH20213(Human)