Ceruloplasmin Antibody

Images

 
Immunohistochemistry-Paraffin: Ceruloplasmin Antibody [NBP1-88116] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ceruloplasmin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YFSGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECLTTDHYTGGMKQKYTVNQCRRQSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSKYKKVVYRQYTDSTFRVPVERKAEEEHLGI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Ceruloplasmin Protein (NBP1-88116PEP)
Publications
Read Publications using NBP1-88116.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%). Reactivity reported in scientific literature (PMID: 23868451)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ceruloplasmin Antibody

  • ceruloplasmin (ferroxidase)
  • ceruloplasmin
  • CP-2
  • EC 1.16.3.1
  • Ferroxidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF4409
Species: Mu
Applications: WB
MAB6967
Species: Hu
Applications: WB
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-78444
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC

Publications for Ceruloplasmin Antibody (NBP1-88116)(2)

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
All Species

Reviews for Ceruloplasmin Antibody (NBP1-88116) (0)

There are no reviews for Ceruloplasmin Antibody (NBP1-88116). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Ceruloplasmin Antibody (NBP1-88116). (Showing 1 - 1 of 1 FAQs).

  1. We want to set up a Ceruloplasmin enzyme immunoassay. Could you suggest a suitable/optimal antibody pair for a sandwich format?
    • Currently we do not carry any validated antibody pairs for sandwich ELISA to detect ceruloplasmin, however we do have ELISA kits that have been optimized and validated for human and rat.

Secondary Antibodies

 

Isotype Controls

Additional Ceruloplasmin Products

Bioinformatics Tool for Ceruloplasmin Antibody (NBP1-88116)

Discover related pathways, diseases and genes to Ceruloplasmin Antibody (NBP1-88116). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ceruloplasmin Antibody (NBP1-88116)

Discover more about diseases related to Ceruloplasmin Antibody (NBP1-88116).
 

Pathways for Ceruloplasmin Antibody (NBP1-88116)

View related products by pathway.

PTMs for Ceruloplasmin Antibody (NBP1-88116)

Learn more about PTMs related to Ceruloplasmin Antibody (NBP1-88116).

Blogs on Ceruloplasmin

There are no specific blogs for Ceruloplasmin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ceruloplasmin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CP
Entrez
Uniprot