Ceruloplasmin Antibody - BSA Free

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ceruloplasmin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Ceruloplasmin Antibody - BSA Free (NBP1-88116) is a polyclonal antibody validated for use in IHC. Anti-Ceruloplasmin Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YFSGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECLTTDHYTGGMKQKYTVNQCRRQSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSKYKKVVYRQYTDSTFRVPVERKAEEEHLGI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Ceruloplasmin Protein (NBP1-88116PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%). Reactivity reported in scientific literature (PMID: 23868451)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ceruloplasmin Antibody - BSA Free

• ceruloplasmin (ferroxidase)
• ceruloplasmin
• CP-2
• EC 1.16.3.1
• Ferroxidase

Background

The protein encoded by the Ceruloplasmin gene is a metalloprotein that binds most of the copper in plasma and is involved in theperoxidation of Fe(II)transferrin to Fe(III) transferrin. Mutations in this gene cause aceruloplasminemia, whichresults in iron accumulation and tissue damage, and is associated with diabetes and neurologic abnormalities.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Ceruloplasmin Antibody (NBP1-88116)(2)

Publications using NBP1-88116

• Hametner S, Wimmer I, Haider L et al. Iron and neurodegeneration in the multiple sclerosis brain. Ann Neurol 2013-12-01 [PMID: 23868451] (IF/IHC)
• Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011-11-17 [PMID: 22093360]

FAQs for Ceruloplasmin Antibody (NBP1-88116). (Showing 1 - 1 of 1 FAQs).

1. We want to set up a Ceruloplasmin enzyme immunoassay. Could you suggest a suitable/optimal antibody pair for a sandwich format?
   • Currently we do not carry any validated antibody pairs for sandwich ELISA to detect ceruloplasmin, however we do have ELISA kits that have been optimized and validated for human and rat.

Bioinformatics

• Gene Symbol: CP
• Entrez:
  • 1356(Human)
• Uniprot:
  • P00450(Human)