CENPJ Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CENPJ Antibody [NBP2-57029] - Staining of human cell line BJ shows localization to nucleoplasm, plasma membrane & centrosome.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CENPJ Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DRERGISSREDSPQVCDDKGPFKDTRTQEDKRRDVDLDLSDKDYSSDESIMESIKHKVSEPSRSSSLSLSKMDFDDERTWTDLEENLCNHDVVLGNESTYGTPQTCYPNNEIGILDKTIKRKIAPVK
Specificity
Specificity of human CENPJ antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CENPJ
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CENPJ Recombinant Protein Antigen (NBP2-57029PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CENPJ Antibody

  • BM032
  • CENP-J
  • centromere protein J
  • Centrosomal P4.1-associated protein
  • CPAPMCPH6
  • LAG-3-associated protein
  • LAPSCKL4
  • LIP1microcephaly, primary autosomal recessive 6
  • LYST-interacting protein 1
  • LYST-interacting protein LIP1
  • LYST-interacting protein LIP7
  • MGC131581
  • MGC131582
  • MGC142222
  • MGC142224
  • Sas-4
  • SASS4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89133
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP2-24614
Species: Hu, Mu, Rt, Ma-Op, Pm
Applications: WB
NBP1-87345
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24643
Species: Mu, Rt
Applications: WB
NBP3-04411
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
7270-IL/CF
Species: Hu
H00023049-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00002678-M01
Species: Hu, Mu, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NB110-3638
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI

Publications for CENPJ Antibody (NBP2-57029) (0)

There are no publications for CENPJ Antibody (NBP2-57029).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENPJ Antibody (NBP2-57029) (0)

There are no reviews for CENPJ Antibody (NBP2-57029). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CENPJ Antibody (NBP2-57029) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CENPJ Products

Bioinformatics Tool for CENPJ Antibody (NBP2-57029)

Discover related pathways, diseases and genes to CENPJ Antibody (NBP2-57029). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CENPJ Antibody (NBP2-57029)

Discover more about diseases related to CENPJ Antibody (NBP2-57029).
 

Pathways for CENPJ Antibody (NBP2-57029)

View related products by pathway.

PTMs for CENPJ Antibody (NBP2-57029)

Learn more about PTMs related to CENPJ Antibody (NBP2-57029).
 

Research Areas for CENPJ Antibody (NBP2-57029)

Find related products by research area.

Blogs on CENPJ

There are no specific blogs for CENPJ, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CENPJ Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPJ