CEND1 Antibody

Images

 
Western Blot: CEND1 Antibody [NBP1-70495] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CEND1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CEND1(cell cycle exit and neuronal differentiation 1) The peptide sequence was selected from the N terminal of CEND1. Peptide sequence MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEND1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CEND1 and was validated on Western blot.
Theoretical MW
15 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CEND1 Antibody

  • BM88 antigen
  • cell cycle exit and neuronal differentiation 1
  • cell cycle exit and neuronal differentiation protein 1
  • FLJ90066

Background

CEND1 is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. The protein encoded by this gene is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. Multiple pseudogenes have been reported for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
44450002
Species: Hu
Applications: WB, ELISA
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
AF4937
Species: Hu
Applications: WB, IHC
NBP1-47871
Species: Hu, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
AF2567
Species: Mu
Applications: WB, IHC
NBP1-30741
Species: Hu, Mu, Rt, GP
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
AF1555
Species: Hu
Applications: WB
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-70495
Species: Hu
Applications: WB

Publications for CEND1 Antibody (NBP1-70495) (0)

There are no publications for CEND1 Antibody (NBP1-70495).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEND1 Antibody (NBP1-70495) (0)

There are no reviews for CEND1 Antibody (NBP1-70495). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CEND1 Antibody (NBP1-70495) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEND1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEND1