RGC32 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RGC32 Antibody [NBP2-56182] - Staining of human cell line CACO-2 shows localization to nucleus & nucleoli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RGC32 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSDALCEFDAVLADFASPFHERHFHYEEHLERMK
Specificity
Specificity of human RGC32 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RGCC
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RGC32 Recombinant Protein Antigen (NBP2-56182PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RGC32 Antibody

  • bA157L14.2
  • chromosome 13 open reading frame 15
  • KIAA0564
  • RGC-32MGC87338
  • RGC32response gene to complement 32 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-00776
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
AF1555
Species: Hu
Applications: WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-24695
Species: Hu
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90949
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-03198
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NB300-709
Species: Hu, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RGC32 Antibody (NBP2-56182) (0)

There are no publications for RGC32 Antibody (NBP2-56182).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGC32 Antibody (NBP2-56182) (0)

There are no reviews for RGC32 Antibody (NBP2-56182). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RGC32 Antibody (NBP2-56182) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RGC32 Products

Bioinformatics Tool for RGC32 Antibody (NBP2-56182)

Discover related pathways, diseases and genes to RGC32 Antibody (NBP2-56182). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for RGC32 Antibody (NBP2-56182)

Find related products by research area.

Blogs on RGC32

There are no specific blogs for RGC32, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGC32 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RGCC