RGC32 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RGC32 Antibody [NBP2-56182] - Staining of human cell line CACO-2 shows localization to nucleus & nucleoli.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RGC32 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RGC32 Antibody - BSA Free (NBP2-56182) is a polyclonal antibody validated for use in ICC/IF. Anti-RGC32 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSDALCEFDAVLADFASPFHERHFHYEEHLERMK
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RGCC
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RGC32 Recombinant Protein Antigen (NBP2-56182PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RGC32 Antibody - BSA Free

• bA157L14.2
• chromosome 13 open reading frame 15
• KIAA0564
• RGC-32MGC87338
• RGC32response gene to complement 32 protein

Background

RGC32 is thought to regulate cell cycle progression. It is induced by p53 in response to DNA damage, or by sublytic levels of complement system proteins that result in activation of the cell cycle. The encoded protein localizes to the cytoplasm during interphase and to centrosomes during mitosis. The protein forms a complex with polo-like kinase 1. The protein also translocates to the nucleus in response to treatment with complement system proteins, and can associate with and increase the kinase activity of cell division cycle 2 protein. In different assays and cell types, overexpression of this protein has been shown to activate or suppress cell cycle progression. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RGC32 Antibody (NBP2-56182)(1)

Publication using NBP2-56182

• Liu C, Stocke K, Fitzsimonds ZR et al. A bacterial tyrosine phosphatase modulates cell proliferation through targeting RGCC PLoS pathogens 2021-05-01 [PMID: 34015051]

Review for RGC32 Antibody (NBP2-56182) (1)

Average Rating: 1

(Based on 1 review)

We have 1 review tested in 1 species: Rat.

reviewed by: Parisa Shabani IHC-Fr Rat 06/27/2022

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: Adult heart
• Species: Rat
• Lot: 000033224

Comments

• Comments: ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***

Bioinformatics

• Gene Symbol: RGCC