CEACAM7 Antibody

Images

 
Western Blot: CEACAM-7 Antibody [NBP1-68887] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CEACAM7 Antibody Summary

Immunogen
Synthetic peptides corresponding to CEACAM7 (carcinoembryonic antigen-related cell adhesion molecule 7) The peptide sequence was selected from the N terminal of CEACAM7. Peptide sequence NLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEACAM7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CEACAM7 and was validated on Western blot.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CEACAM7 Antibody

  • Carcinoembryonic antigen CGM 2
  • Carcinoembryonic antigen CGM2
  • Carcinoembryonic antigen gene family member 2
  • Carcinoembryonic antigen related cell adhesion molecule 7
  • CEA
  • CEACAM 7
  • CEACAM7
  • CEACAM-7
  • CGM 2
  • CGM2

Background

The function of CEACAM7 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB3934
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-68887
Species: Hu
Applications: WB

Publications for CEACAM7 Antibody (NBP1-68887) (0)

There are no publications for CEACAM7 Antibody (NBP1-68887).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEACAM7 Antibody (NBP1-68887) (0)

There are no reviews for CEACAM7 Antibody (NBP1-68887). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CEACAM7 Antibody (NBP1-68887) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CEACAM7 Products

Bioinformatics Tool for CEACAM7 Antibody (NBP1-68887)

Discover related pathways, diseases and genes to CEACAM7 Antibody (NBP1-68887). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEACAM7 Antibody (NBP1-68887)

Discover more about diseases related to CEACAM7 Antibody (NBP1-68887).
 

Pathways for CEACAM7 Antibody (NBP1-68887)

View related products by pathway.

PTMs for CEACAM7 Antibody (NBP1-68887)

Learn more about PTMs related to CEACAM7 Antibody (NBP1-68887).

Blogs on CEACAM7

There are no specific blogs for CEACAM7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEACAM7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEACAM7
Entrez
Uniprot