CDNF Antibody


Western Blot: CDNF Antibody [NBP1-88994] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane more
Immunohistochemistry-Paraffin: CDNF Antibody [NBP1-88994] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CDNF Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATH
Specificity of human CDNF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CDNF Protein (NBP1-88994PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CDNF Antibody

  • arginine-rich, mutated in early stage tumors-like 1
  • ARMET-like protein 1
  • CDNF
  • cerebral dopamine neurotrophic factor
  • Conserved dopamine neurotrophic factor


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Mu
Applications: WB, IHC, Neut
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Rt
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt, Po, Ca, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CDNF Antibody (NBP1-88994) (0)

There are no publications for CDNF Antibody (NBP1-88994).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDNF Antibody (NBP1-88994) (0)

There are no reviews for CDNF Antibody (NBP1-88994). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDNF Antibody (NBP1-88994) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CDNF Products

Bioinformatics Tool for CDNF Antibody (NBP1-88994)

Discover related pathways, diseases and genes to CDNF Antibody (NBP1-88994). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDNF Antibody (NBP1-88994)

Discover more about diseases related to CDNF Antibody (NBP1-88994).

Pathways for CDNF Antibody (NBP1-88994)

View related products by pathway.

PTMs for CDNF Antibody (NBP1-88994)

Learn more about PTMs related to CDNF Antibody (NBP1-88994).

Blogs on CDNF

There are no specific blogs for CDNF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CDNF Antibody and receive a gift card or discount.


Gene Symbol CDNF