CDKN3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CDKN3 Antibody [NBP2-58459] - Staining of human cell line PC-3 shows localization to cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CDKN3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CDKN3 Antibody - BSA Free (NBP2-58459) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDKN3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CDKN3 Recombinant Protein Antigen (NBP2-58459PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CDKN3 Antibody - BSA Free

• CDI1KAP1
• CDK2-associated dual specificity phosphatase
• CDK2-associated dual-specificity phosphatase
• Cdk-associated protein phosphatase
• CIP2
• cyclin-dependent kinase inhibitor 3
• cyclin-dependent kinase interacting protein 2
• Cyclin-dependent kinase interactor 1
• Cyclin-dependent kinase-interacting protein 2
• EC 3.1.3.16
• EC 3.1.3.48
• FLJ25787
• KAPMGC70625
• Kinase-associated phosphatase

Background

CDKN3 is encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDKN3