KCNN2 Antibody - BSA Free

Western Blot: KCNN2 Antibody [NBP2-84112] - Host: Rabbit. Target Name: KCNN2. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml

Immunohistochemistry: KCNN2 Antibody [NBP2-84112] - Sample Type: Rhesus macaque spinal cord. Primary Antibody Dilution: 1:300. Secondary Antibody: Donkey anti Rabbit 488. Secondary Antibody Dilution: 1:500. Color/Signal Descriptions: Green: KCNN2. Gene Name: KCNN2. Submitted by: Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706

Western Blot: KCNN2 Antibody [NBP2-84112] - WB Suggested Anti-KCNN2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Muscle

Western Blot: KCNN2 Antibody [NBP2-84112] - Host: Rabbit. Target Name: KCNN2. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml

Western Blot: KCNN2 Antibody [NBP2-84112] - Host: Rabbit. Target Name: KCNN2. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml

Western Blot: KCNN2 Antibody [NBP2-84112] - Host: Rabbit. Target: KCNN2. Positive control (+): Human liver (LI). Negative control (-): HeLa (HL). Antibody concentration: 1ug/ml

• Reactivity: Hu, Pm
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

KCNN2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KCNN2 Antibody - BSA Free (NBP2-84112) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNN2. Peptide sequence: KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for KCNN2 Antibody - BSA Free

• hSK2
• KCa2.2
• KCa2.2SKCA2
• KCNN2
• potassium intermediate/small conductance calcium-activated channel, subfamilyN, member 2
• SK2apamin-sensitive small-conductance Ca2+-activated potassium channel
• SKCa 2
• SKCa2
• small conductance calcium-activated potassium channel protein 2

Background

Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by this gene is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This gene is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNN2