Cdc14A Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Cdc14A Antibody [NBP1-84573] - Staining of human cell line A-431 shows localization to nucleoplasm, nuclear bodies & cytosol. Antibody staining is shown in green.

Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.

Staining of human lymph node shows moderate nuclear positivity in non-germinal center cells.

Staining of human duodenum shows moderate nuclear positivity in glandular cells.

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu, Pm
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cdc14A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cdc14A Antibody - BSA Free (NBP1-84573) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-Cdc14A Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSGLDDMSIGGNLSKTQNMERFGEDNLEDDDVEMKNGITQGDKLRAL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDC14A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Cdc14A Protein (NBP1-84573PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (82%). Monkey reactivity reported in scientific literature (PMID: 29293958).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Cdc14A Antibody - BSA Free

• CDC10 (cell division cycle 10, S. cerevisiae, homolog)
• CDC14 cell division cycle 14 homolog A (S. cerevisiae)
• CDC14 cell division cycle 14 homolog A
• cdc14
• Cdc14A1
• Cdc14A2
• dual specificity protein phosphatase CDC14A
• EC 3.1.3.16
• EC 3.1.3.48
• hCDC14

Background

Overproduction of hCdc14A leads to progressive cell death, accompanied by accumulation of pre-G1 DNA fragments and gradual elimination of cells at the G2/M transition. In 50% of the mitotic cells, multipolar mitotic spindles and misaggregated chromosomes are found. hCdc14A localizes to the centrosomes at the cell-cycle interphase stage. When the cell enters mitosis, this localization disappears suggesting that hCdc14A dissociates from the centrosomes at the G2/M transition. hCdc14A localizes to interphase centrosomes, but not to mitotic centrosomes, while hCdc14B localizes to the interphase nucleolus. Thus each isoform regulates separate cell cycle events. Cdc14A may affect cell cycle progression by its ability to dephosphorylate p53 at Ser315. This phosphatase activity is mediated by the interaction between the N-terminus of hCdc14A and the C-terminus of p53.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cdc14A Antibody (NBP1-84573)(1)

Publication using NBP1-84573

• Imtiaz A, Belyantseva IA, Beirl AJ et al. CDC14A Phosphatase is Essential for Hearing and Male Fertility in Mouse and Human. Hum. Mol. Genet. 2017-12-23 [PMID: 29293958] (Monkey)

Bioinformatics

• Gene Symbol: CDC14A