CD98 Recombinant Protein Antigen

Images

 
There are currently no images for CD98 Protein (NBP2-47515PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD98 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC3A2.

Source: E. coli

Amino Acid Sequence: KGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC3A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47515.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD98 Recombinant Protein Antigen

  • 4F2
  • 4F2hc
  • 4T2HC
  • antigen identified by monoclonal antibodies 4F2, TRA1.10, TROP4, and T43,4F2HC
  • CD98 antigen
  • CD98 heavy chain
  • CD98
  • CD98HC
  • CH98hc
  • FRP-1
  • heavy chain
  • Lymphocyte activation antigen 4F2 large subunit
  • MDU1antigen defined by monoclonal 4F2, heavy chain
  • monoclonal 44D7
  • NACAE4F2 cell-surface antigen heavy chain
  • SLC3A2
  • solute carrier family 3 (activators of dibasic and neutral amino acidtransport), member 2,4F2 heavy chain antigen

Background

The CD98 gene is a member of the solute carrier family and encodes a cell surface, transmembrane protein with an alpha amylase domain. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50465
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC,  IHC-P
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP2-27104
Species: Hu, Mu, Pm
Applications: IHC,  IHC-P, WB
NBP1-47989
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB300-318
Species: Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC,  IHC-P, IP (-), Simple Western, WB
AF4066
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP1-82826
Species: Hu
Applications: IHC,  IHC-P, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
AF972
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
NBP2-93638
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-75086
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
202-IL
Species: Hu
Applications: BA
5396-SF
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA
NBP2-46175
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-12294
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, IP, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB

Publications for CD98 Protein (NBP2-47515PEP) (0)

There are no publications for CD98 Protein (NBP2-47515PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD98 Protein (NBP2-47515PEP) (0)

There are no reviews for CD98 Protein (NBP2-47515PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD98 Protein (NBP2-47515PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD98 Products

Research Areas for CD98 Protein (NBP2-47515PEP)

Find related products by research area.

Blogs on CD98.

CD98 - cell surface glycoprotein that promotes cell adhesion, growth, and survival
CD98 is a heterodimeric glycoprotein that contains an 80 kDa heavy chain and a 40 kDa light chain. The CD98 heavy chain is also known as the 4F2 antigen heavy chain or FRP-1, and it is encoded by the SLC3A2 gene. The CD98 heavy chain is capable of...  Read full blog post.

xCT: Friend or Foe?
There are two opposing sides to the controversial cysteine/glutamate antiporter. On one hand, it can be viewed a guardian of the cell, protecting it from the damaging oxidative stress that can cause cell death and even cancer. But, conversely, it has ...  Read full blog post.

Glutathione and xCT: Chemoresistance in Tumor Cells
Glutathione, called GSH in its reduced form and GSSG or L(-)-Glutathione in its oxidized form, is an endogenous antioxidant found in most cells in the body. Glutathione's functions include detoxifying xenobiotics from the body, assisting in membrane t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD98 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC3A2