CD90/Thy1 Recombinant Protein Antigen

Images

 
There are currently no images for CD90/Thy1 Recombinant Protein Antigen (NBP2-52961PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD90/Thy1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD90/Thy1.

Source: E. coli

Amino Acid Sequence: VTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
THY1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52961.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD90/Thy1 Recombinant Protein Antigen

  • CD90 antigen
  • CD90
  • CDw90
  • FLJ33325
  • Thy-1 antigen
  • Thy-1 cell surface antigen
  • thy-1 membrane glycoprotein
  • Thy-1 T-cell antigen
  • Thy1

Background

CD90 (Thy1) antigen is a GPI linked glycoprotein member of the Immunoglobulin superfamily. It is expressed on murine T cells, thymocytes, neural cells, cells of granulocytic lineage, early hematopoietic progenitors, fibroblasts, neurons and Kupffer's cells. Thy1 may play a role in cell to cell or cell to ligand interactions during synaptogenesis and other events in the brain. It is found in most mouse strains except AKR/J, A, Thy1.1 and B6.PL (74NS) expressing Thy1.1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4117
Species: Rt
Applications: IHC, WB
AF1320
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr,  IHC-P
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
H00009242-M01
Species: Hu
Applications: ELISA, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
AF1172
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF3628
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NB110-41083
Species: Hu
Applications: ELISA, WB
NB120-16518
Species: Hu, Mu, Po, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
DC140
Species: Hu
Applications: ELISA
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF2335
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
NBP2-52961PEP
Species: Hu
Applications: AC

Publications for CD90/Thy1 Recombinant Protein Antigen (NBP2-52961PEP) (0)

There are no publications for CD90/Thy1 Recombinant Protein Antigen (NBP2-52961PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD90/Thy1 Recombinant Protein Antigen (NBP2-52961PEP) (0)

There are no reviews for CD90/Thy1 Recombinant Protein Antigen (NBP2-52961PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD90/Thy1 Recombinant Protein Antigen (NBP2-52961PEP). (Showing 1 - 1 of 1 FAQ).

  1. We are interested in CD90 antibodies that could react with dog, please let me know which products in your catalog you would recommend.
    • I would recommend one of theses <a href="http://www.novusbio.com/productsearch/CD90%252FThy1#fq=common_name%3A%22CD90%2FThy1%22&fq=species%3A%22Canine%22" target="_self">CD90 antibodies</a>, as these have all been validated for use with dog/canine samples.

Additional CD90/Thy1 Products

Research Areas for CD90/Thy1 Recombinant Protein Antigen (NBP2-52961PEP)

Find related products by research area.

Blogs on CD90/Thy1.

CD90 (Cluster of differentiation 90)
CD90 is a 25-35kD glycosylphosphatidylinositol (GPI)-linked glycoprotein receptor of the immunoglobulin (Ig) superfamily. It is found on murine T-cells, thymocytes, neuronal cells, granulocytic lineage-derived cells, hematopoietic stem cells, fibrobla...  Read full blog post.

How New Oval Stem Cell Marker Antibodies Will Benefit Hepatic Research
A large number of antibody suppliers supply conjugated and non-conjugated marker antibodies, targeted at specific stem cell populations. Until recently the number of oval stem cell markers was extremely limited. However, we at Novus Biologicals have s...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD90/Thy1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol THY1