CD68/SR-D1 Antibody


Genetic Strategies: Western Blot: CD68/SR-D1 Antibody [NBP2-48923] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. more
Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923] - Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923] - Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in a subset of non-germinal center cells.
Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923] - Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in tissue macrophages.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923] - Staining in human tonsil and skeletal muscle tissues. Corresponding CD68 RNA-seq data are presented for the same tissues.
Western Blot: CD68/SR-D1 Antibody [NBP2-48923] - Analysis in human spleen tissue.
Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923] - Immunohistochemical staining of human skeletal muscle shows no positivity as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P, KD

Order Details

CD68/SR-D1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG
Specificity of human CD68/SR-D1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
CD68/SR-D1 Lysate (NBP2-64803)
Control Peptide
CD68/SR-D1 Recombinant Protein Antigen (NBP2-48923PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CD68/SR-D1 Antibody

  • CD68 antigenmacrophage antigen CD68
  • CD68 molecule
  • CD68
  • DKFZp686M18236
  • gp110
  • Macrosialin
  • SCARD1
  • scavenger receptor class D, member 1
  • SRD1
  • SR-D1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Flow
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single Cell Western
Species: Hu
Applications: WB, IHC, IHC-P, KD

Publications for CD68/SR-D1 Antibody (NBP2-48923) (0)

There are no publications for CD68/SR-D1 Antibody (NBP2-48923).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD68/SR-D1 Antibody (NBP2-48923) (0)

There are no reviews for CD68/SR-D1 Antibody (NBP2-48923). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD68/SR-D1 Antibody (NBP2-48923) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CD68/SR-D1 Antibody (NBP2-48923)

Discover related pathways, diseases and genes to CD68/SR-D1 Antibody (NBP2-48923). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD68/SR-D1 Antibody (NBP2-48923)

Discover more about diseases related to CD68/SR-D1 Antibody (NBP2-48923).

Pathways for CD68/SR-D1 Antibody (NBP2-48923)

View related products by pathway.

PTMs for CD68/SR-D1 Antibody (NBP2-48923)

Learn more about PTMs related to CD68/SR-D1 Antibody (NBP2-48923).

Research Areas for CD68/SR-D1 Antibody (NBP2-48923)

Find related products by research area.

Blogs on CD68/SR-D1.

CD68 (Cluster of differentiation 68, GP110, LAMP4, SCARD1)
CD68 belongs to a growing family of hematopoietic mucin-like molecules known as lysosomal/endosomal-associated membrane glycoproteins (LAMPs). Other LAMP family members included leukosialin, stem cell antigen CD34, and GlyCAM-1. CD68 encodes a 110-kD...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CD68/SR-D1 Antibody and receive a gift card or discount.


Gene Symbol CD68