CD68/SR-D1 Antibody - BSA Free

Images

 
Genetic Strategies: Western Blot: CD68/SR-D1 Antibody [NBP2-48923] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. ...read more
Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923] - Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923] - Staining in human tonsil and skeletal muscle tissues . Corresponding CD68 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923] - Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in a subset of non-germinal center cells.
Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923] - Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in tissue macrophages.
Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923] - Immunohistochemical staining of human skeletal muscle shows no positivity as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

CD68/SR-D1 Antibody - BSA Free Summary

Immunogen
This CD68/SR-D1 Antibody was developed against a recombinant protein corresponding to amino acids: SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD68
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD68/SR-D1 Recombinant Protein Antigen (NBP2-48923PEP)
Publications
Read Publication using NBP2-48923.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD68/SR-D1 Antibody - BSA Free

  • CD_antigen: CD68
  • CD68 antigen
  • CD68 molecule
  • CD68
  • DKFZp686M18236
  • gp110
  • LAMP4
  • macrophage antigen CD68
  • Macrosialin
  • SCARD1
  • scavenger receptor class D, member 1
  • SRD1
  • SR-D1

Background

Human CD68, also known as GP110, LAMP4, Scavenger Receptor D1 (SR-D1) or macrosialin in mouse, encodes a 110-kD transmembrane glycoprotein that belongs to the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. Members of the LAMP family include LAMP-1, LAMP-2, dendritic cell (DC)-LAMP (aka CD208), and brain and dendritic cell-associated (BAD)-LAMP (aka LAMP-5). Unlike the two LAMP domains facing the lysosomal lumen in LAMP-1 and LAMP-2, CD68 has a single LAMP domain containing four cystines spaced 36-37 residues apart along with an N-terminal Mucin-like domain. The 354 amino acid (a.a.) human CD68 and 326 a.a. murine ortholog share 80.6% a.a. sequence identity (1).

CD68 is highly expressed in cells of the mononuclear phagocyte system such as macrophages, microglia, osteoclasts, and myeloid dendritic cells (DCs); and is expressed to a lesser extent in lymphoid cells (CD19+ B lymphocytes and CD4+ T lymphocytes), human umbilical cord mesenchymal stem cells (MSCs), fibroblasts, endothelial cells, multiple non-hematopoietic cancer cell lines, and human arterial intimal smooth muscle cells (SMCs). Expression has been also observed in diseased states for granulocytes and neutrophils, in particular basophils from myeloproliferative disorders and intestinal neutrophils from inflammatory bowel disease (IBD), respectively (1).

Although the function of CD68 has yet to be established, it has often been used as an immunohistochemistry (IHC) marker of inflammation and for granular cell tumors (GCTs). CD68+ tumor associated macrophages (TAMs) has been suggested to be a predictive marker for poor cancer prognosis, but a meta-analysis showed the presence of CD68 is not correlated with survival (2). In addition, a role in hepatic malaria infection has been reported based on the finding that peptide P39 binds CD68, considered a receptor for malaria sporozoite, and inhibits parasite entry into Kupffer cells. CD68 was deemed a member of the Scavenger receptor family due to its upregulation in macrophages following inflammatory stimuli, ability to bind modified LDL, phosphatidylserine, and apoptotic cells, as well as shuttling between the plasma membrane and endosomes. CD68 has been linked to atherogenesis based on binding and internalization of its ligand, oxLDL (1).

References

1. Chistiakov, DA, Killingsworth, MC, Myasoedova, VA. Orekhov AN, Bobryshev YV. (2017) CD68/macrosialin: not just a histochemical marker. Lab Invest. 97:4-13. PMID: 27869795

2. Troiano G, Caponio VCA, Adipietro I, Tepedino M, Santoro R, Laino L, Lo Russo L, Cirillo N, Lo Muzio L. (2019) Prognostic significance of CD68+ and CD163+ tumor associated macrophages in head and neck squamous cell carcinoma: A systematic review and meta-analysis. Oral Oncol. 93:66-75. PMID: 31109698.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF4117
Species: Rt
Applications: IHC, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
M6000B
Species: Mu
Applications: ELISA
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
DC140
Species: Hu
Applications: ELISA
DCP00
Species: Hu
Applications: ELISA
NBP1-87102
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87103
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF3844
Species: Hu, Mu
Applications: IHC
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB

Publications for CD68/SR-D1 Antibody (NBP2-48923)(1)

Reviews for CD68/SR-D1 Antibody (NBP2-48923) (0)

There are no reviews for CD68/SR-D1 Antibody (NBP2-48923). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD68/SR-D1 Antibody (NBP2-48923) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD68/SR-D1 Products

Research Areas for CD68/SR-D1 Antibody (NBP2-48923)

Find related products by research area.

Blogs on CD68/SR-D1.

CD68 (Cluster of differentiation 68, GP110, LAMP4, SCARD1)
CD68 belongs to a growing family of hematopoietic mucin-like molecules known as lysosomal/endosomal-associated membrane glycoproteins (LAMPs). Other LAMP family members included leukosialin, stem cell antigen CD34, and GlyCAM-1. CD68 encodes a 110-kD ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD68/SR-D1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CD68