Recombinant Human CD63 Protein

Images

 
There are currently no images for CD63 Recombinant Protein (H00000967-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Func

Order Details

Recombinant Human CD63 Protein Summary

Description
An un-tagged recombinant protein corresponding to the amino acids 1-238 of Human CD63 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM

Protein/Peptide Type
Recombinant Protein
Gene
CD63

Applications/Dilutions

Publications
Read Publication using H00000967-G01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD63 Protein

  • CD63 antigen (melanoma 1 antigen)
  • CD63 antigen
  • CD63 molecule
  • CD63
  • Granulophysin
  • Lamp-3
  • Lysosomal-associated membrane protein 3
  • ME491
  • melanoma 1 antigen
  • Melanoma-associated antigen ME491
  • melanoma-associated antigen MLA1
  • MLA1lysosome-associated membrane glycoprotein 3
  • Ocular melanoma-associated antigen
  • OMA81H
  • tetraspanin-30
  • Tspan30
  • tspan-30
  • TSPAN30granulophysin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-22187
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
NB100-65805
Species: Hu, Gt, Pm, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB5756
Species: Hu
Applications: Flow
MAB4609
Species: Mu
Applications: Flow, CyTOF-ready, ICC
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
MAB4624
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-14934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP

Publications for CD63 Recombinant Protein (H00000967-G01)(1)

Reviews for CD63 Recombinant Protein (H00000967-G01) (0)

There are no reviews for CD63 Recombinant Protein (H00000967-G01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for CD63 Recombinant Protein (H00000967-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD63 Products

Bioinformatics Tool for CD63 Recombinant Protein (H00000967-G01)

Discover related pathways, diseases and genes to CD63 Recombinant Protein (H00000967-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD63 Recombinant Protein (H00000967-G01)

Discover more about diseases related to CD63 Recombinant Protein (H00000967-G01).
 

Pathways for CD63 Recombinant Protein (H00000967-G01)

View related products by pathway.

PTMs for CD63 Recombinant Protein (H00000967-G01)

Learn more about PTMs related to CD63 Recombinant Protein (H00000967-G01).
 

Research Areas for CD63 Recombinant Protein (H00000967-G01)

Find related products by research area.

Blogs on CD63.

Tools for Isolation, Quantification and Analysis of Exosomes
Exosomes are spherical to cup-shaped bilayered membrane enclosed nanosize vesicles (30-100 nm) which have the ability to shuttle active cargoes between cells. Johnstone et al. 1987 pioneered in documenting the generation of exosomes in differentiat...  Read full blog post.

CD63: is it pro-metastatic or anti-metastatic?
CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,...  Read full blog post.

Customers Who Bought This Also Bought

IL-3 [Unconjugated]
203-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD63 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CD63
Entrez