CD55/DAF Antibody

Images

 
Western Blot: CD55/DAF Antibody [NBP1-85467] - Analysis in human cell line HeLa.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85467] - Immunohistochemistry analysis in human lung and pancreas tissues using NBP1-85467 antibody. Corresponding CD55 RNA-seq data ...read more
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85467] - Staining of human lung shows high expression.
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85467] - Staining of human kidney shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85467] - Staining in human lung and kidney tissues using anti-CD55 antibody. Corresponding CD55 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85467] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85467] - Staining of human lung shows strong cytoplasmic positivity in pneumocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CD55/DAF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSGHTCFTLTGLLGTLVTMG
Specificity
Specificity of human CD55/DAF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD55
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended
Control Peptide
CD55/DAF Protein (NBP1-85467PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD55/DAF Antibody

  • CD55 antigen
  • CD55 molecule, decay accelerating factor for complement (Cromer blood group)
  • CD55
  • CR
  • CRdecay accelerating factor for complement (CD55, Cromer blood group system)
  • CROMDAFcomplement decay-accelerating factor
  • DAF
  • decay accelerating factor for complement
  • TC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
7268-CT
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB500-330
Species: Hu
Applications: Flow, IHC, IHC-P, IP, B/N, CyTOF-ready
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90215
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB600-609
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for CD55/DAF Antibody (NBP1-85467) (0)

There are no publications for CD55/DAF Antibody (NBP1-85467).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD55/DAF Antibody (NBP1-85467) (0)

There are no reviews for CD55/DAF Antibody (NBP1-85467). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD55/DAF Antibody (NBP1-85467) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CD55/DAF Antibody (NBP1-85467)

Discover related pathways, diseases and genes to CD55/DAF Antibody (NBP1-85467). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD55/DAF Antibody (NBP1-85467)

Discover more about diseases related to CD55/DAF Antibody (NBP1-85467).
 

Pathways for CD55/DAF Antibody (NBP1-85467)

View related products by pathway.

PTMs for CD55/DAF Antibody (NBP1-85467)

Learn more about PTMs related to CD55/DAF Antibody (NBP1-85467).
 

Research Areas for CD55/DAF Antibody (NBP1-85467)

Find related products by research area.

Blogs on CD55/DAF

There are no specific blogs for CD55/DAF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD55/DAF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD55
Entrez