CD55/DAF Antibody

Images

 
Immunohistochemistry: CD55/DAF Antibody [NBP1-85466] - Staining of human lung shows strong membranous positivity in alveolar cells.

Product Details

Summary
Reactivity Hu, FeSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD55/DAF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD55
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD55/DAF Protein (NBP1-85466PEP)
Publications
Read Publication using
NBP1-85466 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Feline reactivity reported in scientific literature (PMID: 25671605).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD55/DAF Antibody

  • CD55 antigen
  • CD55 molecule, decay accelerating factor for complement (Cromer blood group)
  • CD55
  • CR
  • CRdecay accelerating factor for complement (CD55, Cromer blood group system)
  • CROMDAFcomplement decay-accelerating factor
  • DAF
  • decay accelerating factor for complement
  • TC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB500-330
Species: Hu
Applications: B/N, Flow, IHC, IHC-P, IP, CyTOF-ready
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF7177
Species: Hu
Applications: WB, ICC
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CD55/DAF Antibody (NBP1-85466)(1)

We have publications tested in 1 confirmed species: Feline.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Feline
(1)
All Species

Reviews for CD55/DAF Antibody (NBP1-85466) (0)

There are no reviews for CD55/DAF Antibody (NBP1-85466). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD55/DAF Antibody (NBP1-85466) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD55/DAF Products

Bioinformatics Tool for CD55/DAF Antibody (NBP1-85466)

Discover related pathways, diseases and genes to CD55/DAF Antibody (NBP1-85466). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD55/DAF Antibody (NBP1-85466)

Discover more about diseases related to CD55/DAF Antibody (NBP1-85466).
 

Pathways for CD55/DAF Antibody (NBP1-85466)

View related products by pathway.

PTMs for CD55/DAF Antibody (NBP1-85466)

Learn more about PTMs related to CD55/DAF Antibody (NBP1-85466).
 

Research Areas for CD55/DAF Antibody (NBP1-85466)

Find related products by research area.

Blogs on CD55/DAF

There are no specific blogs for CD55/DAF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD55/DAF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD55
Entrez