![Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining in human lung and kidney tissues using anti-CD55 antibody. Corresponding CD55 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/CD55-DAF-Antibody-Immunohistochemistry-Paraffin-NBP1-85466-img0007.jpg "Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining in human lung and kidney tissues using anti-CD55 antibody. Corresponding CD55 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, FeSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISF |
| Specificity | Specificity of human CD55/DAF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CD55 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC, WB reported in scientific literature (PMID: 25671605). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for CD55/DAF Antibody (NBP1-85466)Discover more about diseases related to CD55/DAF Antibody (NBP1-85466).
| Pathways for CD55/DAF Antibody (NBP1-85466)View related products by pathway.
|
PTMs for CD55/DAF Antibody (NBP1-85466)Learn more about PTMs related to CD55/DAF Antibody (NBP1-85466).
| Research Areas for CD55/DAF Antibody (NBP1-85466)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CD55 |
![Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining of human kidney shows low expression as expected.](http://images.novusbio.com/fullsize2/CD55-DAF-Antibody-Immunohistochemistry-Paraffin-NBP1-85466-img0004.jpg "Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining of human kidney shows low expression as expected.")
![Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining of human lung shows high expression.](http://images.novusbio.com/fullsize2/CD55-DAF-Antibody-Immunohistochemistry-Paraffin-NBP1-85466-img0005.jpg "Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining of human lung shows high expression.")
![Immunocytochemistry/Immunofluorescence: Histatin 3 Antibody (4G9) [H00003347-M01] - Analysis of monoclonal antibody to HTN3 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/images2/Histatin-3-Antibody-(4G9)-Immunocytochemistry-Immunofluorescence-H00003347-M01-img0005.jpg)
![Sandwich ELISA: Histatin 3 Antibody (4G9) [H00003347-M01] - Detection limit for recombinant GST tagged HTN3 is approximately 3ng/ml as a capture antibody.](http://images.novusbio.com/images2/Histatin-3-Antibody-(4G9)-Sandwich-ELISA-H00003347-M01-img0006.jpg)
![Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.](http://images.novusbio.com/images2/NOD2-Antibody-(2D9)-Western-Blot-NB100-524-img0013.jpg)
![Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.](http://images.novusbio.com/images2/NOD2-Antibody-(2D9)-Immunohistochemistry-Frozen-NB100-524-img0016.jpg)
![Flow (Intracellular): NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on THP-1 cells with NOD2 (2D9) antibody NB100-524AF488 (blue) and a matched isotype control NBP2-27287AF488 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes.](http://images.novusbio.com/images2/NOD2-Antibody-(2D9)-Flow-(Intracellular)-NB100-524-img0010.jpg)
![Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).](http://images.novusbio.com/images2/HLA-DQ-DR-DP-Antibody-(HLA-Pan-2967R)---Azide-and-BSA-Free-Western-Blot-NBP2-79843-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).](http://images.novusbio.com/images2/HLA-DQ-DR-DP-Antibody-(HLA-Pan-2967R)---Azide-and-BSA-Free-Immunocytochemistry-Immunofluorescence-NBP2-79843-img0002.jpg)
![Immunohistochemistry-Paraffin: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Formalin-fixed, paraffin-embedded human Tonsil stained with HLA DQ/DR/DP Antibody (HLA-Pan/2967R).](http://images.novusbio.com/images2/HLA-DQ-DR-DP-Antibody-(HLA-Pan-2967R)---Azide-and-BSA-Free-Immunohistochemistry-Paraffin-NBP2-79843-img0005.jpg)
![Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. This image was submitted via customer Review.](http://images.novusbio.com/images2/Thyroglobulin-Antibody-(2H11-+-6E1)-Immunohistochemistry-Paraffin-NBP2-34294-img0005.jpg)
![Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).](http://images.novusbio.com/images2/Thyroglobulin-Antibody-(2H11-+-6E1)-Immunohistochemistry-Paraffin-NBP2-34294-img0003.jpg)
![Immunohistochemistry: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.](http://images.novusbio.com/images2/Thyroglobulin-Antibody-(2H11-+-6E1)-Immunohistochemistry-NBP2-34294-img0004.jpg)
![Immunohistochemistry-Paraffin: CD59 Antibody (MEM-43) [NB500-330] - Staining of human placenta (paraffin sections) using anti-CD59 (MEM-43).](http://images.novusbio.com/images2/CD59-Antibody-(MEM-43)-Immunohistochemistry-Paraffin-NB500-330-img0009.jpg)
![Flow Cytometry: CD59 Antibody (MEM-43) [NB500-330] - Surface staining of HL-60 (positive) and SP2 (negative) cells with anti-human CD59 (MEM-43) Pacific BlueTM.](http://images.novusbio.com/images2/CD59-Antibody-(MEM-43)-Flow-Cytometry-NB500-330-img0007.jpg)
![Immunohistochemistry-Frozen: CD59 Antibody (MEM-43) [NB500-330] - Human tonsil frozen tissue section stained for CD59 (red) and counterstained with DAPI (blue). Image from verified customer review.](http://images.novusbio.com/images2/CD59-Antibody-(MEM-43)-Immunohistochemistry-Frozen-NB500-330-img0008.jpg)
![Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Western-Blot-NBP2-34260-img0006.jpg)
![Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-NBP2-34260-img0005.jpg)
![Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)](http://images.novusbio.com/images2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-Paraffin-NBP2-34260-img0002.jpg)
![Flow (Intracellular): Complement C3 Antibody (11H9) [NB200-540] - An intracellular stain was performed on RAW 246.7 cells with Complement C3 (11H9-3-2) antibody NB200-540 (blue) and a matched isotype control NBP2-31382 (orange). Cells were either treated with 3uM Monensin for 3 hours to block the secretion of Complement C3 (B) or grown in normal media (A). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) PE-conjugated secondary antibody (F0102B, R&D Systems).](http://images.novusbio.com/images2/Complement-C3-Antibody-(11H9)-Flow-(Intracellular)-NB200-540-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: Complement C3 Antibody (11H9) [NB200-540] - C3 protein fragments deposited on kidney cells of MPL-lpr mouse. Staining with antibody 11H9. Glomerular staining pattern. Fixation in 4% paraformaldehyde in PBS pH 7.4. Vibratome sections of 4 um. Pretreated with 3% hydrogen peroxide for 20 min to quench endogenous peroxidases. Microwaved in antigen unmasking solution for 2-5 minutes as antigen retrieval.](http://images.novusbio.com/images2/Complement-C3-Antibody-(11H9)-Immunocytochemistry-Immunofluorescence-NB200-540-img0002.jpg)
![Immunohistochemistry-Paraffin: Complement C3 Antibody (11H9) [NB200-540] - Complement C3 protein in a FFPE tissue section of mouse liver using 1:100 dilution of Complement C3 antibody (clone 11H9) NB200-540. Weak but distinct membrane-cytoplasmic immunopositivity was observed in hepatocytes and few cells developed punctate membrane staining.](http://images.novusbio.com/images2/Complement-C3-Antibody-(11H9)-Immunohistochemistry-Paraffin-NB200-540-img0004.jpg)
![Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.](http://images.novusbio.com/images2/Albumin-Antibody-Western-Blot-NB600-41532-img0002.jpg)
![Western Blot: PMEL17/SILV Antibody [NBP1-69571] - Sample Tissue: Human MCF7 Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/images2/PMEL17-SILV-Antibody-Western-Blot-NBP1-69571-img0006.jpg)
![Immunohistochemistry: PMEL17/SILV Antibody [NBP1-69571] - The inflammatory MITFlow/c-Junhigh cell state correlates with increased myeloid cell infiltration in human melanomas. Immunohistochemical analysis for gp100, CD45 and CD14 in representative cases from the Lund melanoma cohort. Small panels show zoom-in views, for example, to visualize morphology of CD45+/CD14+ tumour-infiltrating immune cells. Scale bars, 50 um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/ncomms9755) licensed under a CC-BY licence.](http://images.novusbio.com/images2/PMEL17-SILV-Antibody-Immunohistochemistry-NBP1-69571-img0007.jpg)
![Western Blot: PMEL17/SILV Antibody [NBP1-69571] - This Anti-SILV antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.](http://images.novusbio.com/images2/PMEL17-SILV-Antibody-Western-Blot-NBP1-69571-img0003.jpg)
![Western Blot: SLC17A5 Antibody [NBP2-20383] - Sample (30 ug of whole cell lysate) A: Jurkat 10% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/images2/SLC17A5 Antibody-Western Blot-NBP2-20383-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: SLC17A5 Antibody [NBP2-20383] - Sample: HepG2 cells were fixed in -20C 100% MeOH for 5 min. Green: SLC17A5 protein stained by SLC17A5 antibody diluted at 1:500. Blue: Hoechst 33343 staining.](http://images.novusbio.com/images2/SLC17A5 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-20383-img0003.jpg)
![Immunohistochemistry-Paraffin: Sialin/SLC17A5 Antibody [NBP2-20383] - Mouse lung diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min](http://images.novusbio.com/images2/Sialin-SLC17A5-Antibody-Immunohistochemistry-Paraffin-NBP2-20383-img0004.jpg)
![Western Blot: CapG Antibody [NBP1-90214] - Analysis using Anti-CAPG antibody NBP1-90214 (A) shows similar pattern to independent antibody NBP1-90213 (B).](http://images.novusbio.com/images2/CapG-Antibody-Western-Blot-NBP1-90214-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: CapG Antibody [NBP1-90214] - Staining of human cell line A-431 shows localization to nucleus. Antibody staining is shown in green.](http://images.novusbio.com/images2/CapG-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90214-img0008.jpg)
![Immunohistochemistry-Paraffin: CapG Antibody [NBP1-90214] - Staining of human lung, lymph node, skeletal muscle and small intestine using Anti-CAPG antibody (A) NBP1-90214 shows similar protein distribution across tissues to independent antibody NBP1-90215 (B).](http://images.novusbio.com/images2/CapG Antibody-Immunohistochemistry-Paraffin-NBP1-90214-img0021.jpg)
![Western Blot: Lipoprotein a Antibody (4H1) [NBP2-37477] - Western blot analysis using LPA mAb against human LPA recombinant protein. (Expected MW is 34.1 kDa)](http://images.novusbio.com/images2/Lipoprotein-a-Antibody-(4H1)-Western-Blot-NBP2-37477-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Lipoprotein a Antibody (4H1) [NBP2-37477] - Immunofluorescence analysis of HepG2 cells using LPA mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.](http://images.novusbio.com/images2/Lipoprotein-a-Antibody-(4H1)-Immunocytochemistry-Immunofluorescence-NBP2-37477-img0003.jpg)
![Immunohistochemistry-Paraffin: Lipoprotein a Antibody (4H1) [NBP2-37477] - Analysis of rectum cancer tissues using LPA mouse mAb with DAB staining.](http://images.novusbio.com/images2/Lipoprotein-a-Antibody-(4H1)-Immunohistochemistry-NBP2-37477-img0006.jpg)
![Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.](http://images.novusbio.com/images2/Catalase-Antibody-Western-Blot-NBP2-24916-img0001.jpg)
![Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.](http://images.novusbio.com/images2/Catalase-Antibody-Immunohistochemistry-Paraffin-NBP2-24916-img0002.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")