Home » CD55/DAF » CD55/DAF Antibodies » CD55/DAF Antibody

CD55/DAF Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining in human lung and kidney tissues using anti-CD55 antibody. Corresponding CD55 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining in human lung and kidney tissues using anti-CD55 antibody. Corresponding CD55 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining of human lung shows high expression.

Product Details

Summary
Reactivity Hu, Mu, FeSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

CD55/DAF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD55
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC, WB reported in scientific literature (PMID: 25671605). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD55/DAF Protein (NBP1-85466PEP)
Publications
Read Publications using
NBP1-85466 in the following applications:

  • IHC
    1 publication
  • IHC-P
    1 publication
  • WB
    2 publications

Reactivity Notes

Feline reactivity reported in scientific literature (PMID: 25671605). Use in Mouse reported in scientific literature (PMID:32142650).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD55/DAF Antibody

  • CD55 antigen
  • CD55 molecule, decay accelerating factor for complement (Cromer blood group)
  • CD55
  • CR
  • CRdecay accelerating factor for complement (CD55, Cromer blood group system)
  • CROMDAFcomplement decay-accelerating factor
  • DAF
  • decay accelerating factor for complement
  • TC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Histatin 3
Antibody (4G9)
H00003347-M01
Sandwich ELISA: Histatin 3 Antibody (4G9) [H00003347-M01] - Detection limit for recombinant GST tagged HTN3 is approximately 3ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: Histatin 3 Antibody (4G9) [H00003347-M01] - Analysis of monoclonal antibody to HTN3 on HeLa cell . Antibody concentration 10 ug/ml.
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
HAI-2A
1106-PI
HAI-2A
(3 Publications)
Species: Hu
Applications: InhibAct
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(2 Publications)
Species: Hu
Applications: BA
NOD2 Antibody (2D9)
NB100-524
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(23 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ Antibody
(SPV-L3)
NBP2-45041
Flow Cytometry: HLA DQ Antibody (SPV-L3) [NBP2-45041] - Flow Cytometric Analysis of Raji cells. HLA DQ Antibody (SPV-L3) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
(3 Publications)
Species: Hu, Po
Applications: Flow, ICC/IF, IF
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. IHC-P image submitted by a verified customer review.
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
CD59 Antibody
(MEM-43)
NB500-330
Immunohistochemistry-Frozen: CD59 Antibody (MEM-43) [NB500-330] - Human tonsil frozen tissue section stained for CD59 (red) and counterstained with DAPI (blue). Image from verified customer review.
Immunohistochemistry-Paraffin: CD59 Antibody (MEM-43) [NB500-330] - Staining of human placenta (paraffin sections) using anti-CD59 (MEM-43).
Flow Cytometry: CD59 Antibody (MEM-43) [NB500-330] - Analysis using the PE conjugate of NB500-330. Surface staining of human peripheral blood cells with anti-human CD59 (MEM-43) PE.
(1 Review)
(5 Publications)
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr, IHC-P, IP
CD46 Antibody
(344519)
MAB2005
CD46 Antibody (344519)
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Insulin E2E3, human pancreas (FFPE), HIER pH 9 antigen retrieval. Image from verified customer review.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
(5 Reviews)
(2 Publications)
Species: Bv, Hu, Mu, Po, Rb
Applications: ICC/IF, IHC, IHC-P, WB
Complement C3
Antibody (11H9)
NB200-540
Flow Cytometry: Complement C3 Antibody (11H9) [NB200-540] - Left panel: FMO, Middle panel: No primary antibody control, Right panel: sample. Day 6 murine mammary tumors processed and stained for analysis with flow cytometry. The C3b+ population of CD45+ cells is what the gate in each sample is exhibiting. WB image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Complement C3 Antibody (11H9) [NB200-540] - C3 protein fragments deposited on kidney cells of MPL-lpr mouse. Staining with antibody 11H9. Glomerular staining pattern. Fixation in 4% paraformaldehyde in PBS pH 7.4. Vibratome sections of 4 um. Pretreated with 3% hydrogen peroxide for 20 min to quench endogenous peroxidases. Microwaved in antigen unmasking solution for 2-5 minutes as antigen retrieval.
Immunohistochemistry-Paraffin: Complement C3 Antibody (11H9) [NB200-540] - Complement C3 protein in a FFPE tissue section of mouse lymph node using 1:100 dilution of Complement C3 antibody (clone 11H9) NB200-540. This representative photomicrograph shows a membrane-cytoplasmic immunopositivity in non-germinal center cells, and few cells developed an intense staining for this target protein.
(2 Reviews)
(14 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Albumin Antibody
NB600-41532
Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. WB image submitted by a verified customer review.
(38 Publications)
Species: Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(676 Publications)
Species: Hu
Applications: BA
C-Reactive
Protein/CRP [HRP]
DCRP00
(4 Reviews)
(103 Publications)
Species: Hu
Applications: ELISA
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded breast tissue using anti-PMEL17/SILV mouse monoclonal antibody.
(1 Review)
Species: Ca, Hu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin: Sialin/SLC17A5 Antibody [NBP2-20383] - Mouse lung diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Western Blot: SLC17A5 Antibody [NBP2-20383] - Sample (30 ug of whole cell lysate) A: Jurkat 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SLC17A5 Antibody [NBP2-20383] - Sample: HepG2 cells were fixed in -20C 100% MeOH for 5 min. Green: SLC17A5 protein stained by SLC17A5 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
CapG Antibody
NBP1-90214
Immunocytochemistry/Immunofluorescence: CapG Antibody [NBP1-90214] - Staining of human cell line A-431 shows localization to nucleus. Antibody staining is shown in green.
Western Blot: CapG Antibody [NBP1-90214] - Analysis using Anti-CAPG antibody NBP1-90214 (A) shows similar pattern to independent antibody NBP1-90213 (B).
Immunohistochemistry-Paraffin: CapG Antibody [NBP1-90214] - Analysis in human lung and liver tissues. Corresponding CAPG RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Lipoprotein a
Antibody (4H1)
NBP2-37477
ELISA: Lipoprotein a Antibody (4H1) [NBP2-37477] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: Lipoprotein a Antibody (4H1) [NBP2-37477] - Western blot analysis using LPA mAb against human LPA recombinant protein. (Expected MW is 34.1 kDa)
Immunocytochemistry/Immunofluorescence: Lipoprotein a Antibody (4H1) [NBP2-37477] - Immunofluorescence analysis of HepG2 cells using LPA mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(7 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Apolipoprotein
A-I/ApoA1 Antibody
NB600-609
Apolipoprotein A-I/ApoA1 Antibody
(9 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
CD55/DAF Antibody
NBP1-85466
CD55/DAF Antibody
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P

Publications for CD55/DAF Antibody (NBP1-85466)(2)

We have publications tested in 3 confirmed species: Human, Mouse, Feline.

We have publications tested in 3 applications: IHC, IHC-P, WB.


Filter By Application
IHC
(1)
IHC-P
(1)
WB
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
Feline
(1)
All Species

Reviews for CD55/DAF Antibody (NBP1-85466) (0)

There are no reviews for CD55/DAF Antibody (NBP1-85466). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD55/DAF Antibody (NBP1-85466) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional CD55/DAF Products

Bioinformatics Tool for CD55/DAF Antibody (NBP1-85466)

Discover related pathways, diseases and genes to CD55/DAF Antibody (NBP1-85466). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD55/DAF Antibody (NBP1-85466)

Discover more about diseases related to CD55/DAF Antibody (NBP1-85466).
 

Pathways for CD55/DAF Antibody (NBP1-85466)

View related products by pathway.

PTMs for CD55/DAF Antibody (NBP1-85466)

Learn more about PTMs related to CD55/DAF Antibody (NBP1-85466).
 

Research Areas for CD55/DAF Antibody (NBP1-85466)

Find related products by research area.

Blogs on CD55/DAF

There are no specific blogs for CD55/DAF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD55/DAF Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CD55