Home » CD55/DAF » CD55/DAF Antibodies » CD55/DAF Antibody

CD55/DAF Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining in human lung and kidney tissues using anti-CD55 antibody. Corresponding CD55 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining in human lung and kidney tissues using anti-CD55 antibody. Corresponding CD55 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining of human lung shows high expression.

Product Details

Summary
Reactivity Hu, Mu, FeSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

CD55/DAF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISF
Specificity
Specificity of human CD55/DAF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD55
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
IHC, WB reported in scientific literature (PMID: 25671605). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD55/DAF Protein (NBP1-85466PEP)
Publications
Read Publications using
NBP1-85466 in the following applications:

  • IHC
    1 publication
  • IHC-P
    1 publication
  • WB
    2 publications

Reactivity Notes

Feline reactivity reported in scientific literature (PMID: 25671605). Use in Mouse reported in scientific literature (PMID:32142650).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD55/DAF Antibody

  • CD55 antigen
  • CD55 molecule, decay accelerating factor for complement (Cromer blood group)
  • CD55
  • CR
  • CRdecay accelerating factor for complement (CD55, Cromer blood group system)
  • CROMDAFcomplement decay-accelerating factor
  • DAF
  • decay accelerating factor for complement
  • TC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Histatin 3
Antibody (4G9)
H00003347-M01
Immunocytochemistry/Immunofluorescence: Histatin 3 Antibody (4G9) [H00003347-M01] - Analysis of monoclonal antibody to HTN3 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: Histatin 3 Antibody (4G9) [H00003347-M01] - Detection limit for recombinant GST tagged HTN3 is approximately 3ng/ml as a capture antibody.
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
HAI-2/SPINT2
Antibody [Unconjugate
AF1107
HAI-2/SPINT2 Antibody [Unconjugated]
(2 Publications)
Species: Mu
Applications: WB, IHC
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - HCMV infection induces NOD2 mRNA and protein in HFFs and U373 cells. E. U373 glioma cells were infected with HCMV Towne strain and levels of NOD1, NOD2 and GAPDH mRNAs were measured by qRT-PCR at indicated time points. F. HFFs were infected with HCMV (Towne) at MOI of 1 PFU/cell and levels of NOD2 protein and B-actin were determined 48 and 72 hpi. G. HFFs were infected with HCMV (Towne) strain at MOI of 0.03 or 3 PFU/cell and levels of NOD2 protein and B-actin were determined at 48 hpi. Quantitative data represent mean values (+/-SD) of triplicate determinations from three independent experiments (*p<0.05, **p<0.01, ***p<0.001, one-way ANOVA test). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092704.g001) licensed under a CC-BY licence.
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(20 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
HLA DQ Antibody
(SPV-L3)
NBP2-45041
Flow Cytometry: HLA DQ Antibody (SPV-L3) [NBP2-45041] - Flow Cytometric Analysis of Raji cells. HLA DQ Antibody (SPV-L3) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
(1 Publication)
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
(2 Reviews)
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
CD59 Antibody
(MEM-43)
NB500-330
Immunohistochemistry-Paraffin: CD59 Antibody (MEM-43) [NB500-330] - Staining of human placenta (paraffin sections) using anti-CD59 (MEM-43).
Flow Cytometry: CD59 Antibody (MEM-43) [NB500-330] - Surface staining of HL-60 (positive) and SP2 (negative) cells with anti-human CD59 (MEM-43) Pacific BlueTM.
Immunohistochemistry-Frozen: CD59 Antibody (MEM-43) [NB500-330] - Human tonsil frozen tissue section stained for CD59 (red) and counterstained with DAPI (blue). Image from verified customer review.
(1 Review)
(5 Publications)
Species: Hu
Applications: Flow, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready
CD46 Antibody
(344519)
MAB2005
CD46 Antibody (344519)
(1 Review)
(3 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Complement C3
Antibody (11H9)
NB200-540
Flow (Intracellular): Complement C3 Antibody (11H9) [NB200-540] - An intracellular stain was performed on RAW 246.7 cells with Complement C3 (11H9-3-2) antibody NB200-540 (blue) and a matched isotype control NBP2-31382 (orange). Cells were either treated with 3uM Monensin for 3 hours to block the secretion of Complement C3 (B) or grown in normal media (A). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) PE-conjugated secondary antibody (F0102B, R&D Systems).
Immunocytochemistry/Immunofluorescence: Complement C3 Antibody (11H9) [NB200-540] - C3 protein fragments deposited on kidney cells of MPL-lpr mouse. Staining with antibody 11H9. Glomerular staining pattern. Fixation in 4% paraformaldehyde in PBS pH 7.4. Vibratome sections of 4 um. Pretreated with 3% hydrogen peroxide for 20 min to quench endogenous peroxidases. Microwaved in antigen unmasking solution for 2-5 minutes as antigen retrieval.
Immunohistochemistry-Paraffin: Complement C3 Antibody (11H9) [NB200-540] - Complement C3 protein in a FFPE tissue section of mouse liver using 1:100 dilution of Complement C3 antibody (clone 11H9) NB200-540. Weak but distinct membrane-cytoplasmic immunopositivity was observed in hepatocytes and few cells developed punctate membrane staining.
(2 Reviews)
(9 Publications)
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.
(37 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(645 Publications)
Species: Hu
C-Reactive
Protein/CRP [HRP]
DCRP00
(3 Reviews)
(83 Publications)
Species: Hu
PMEL17/SILV
Antibody
NBP1-69571
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - Sample Tissue: Human MCF7 Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: PMEL17/SILV Antibody [NBP1-69571] - The inflammatory MITFlow/c-Junhigh cell state correlates with increased myeloid cell infiltration in human melanomas. Immunohistochemical analysis for gp100, CD45 and CD14 in representative cases from the Lund melanoma cohort. Small panels show zoom-in views, for example, to visualize morphology of CD45+/CD14+ tumour-infiltrating immune cells. Scale bars, 50 um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/ncomms9755) licensed under a CC-BY licence.
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - This Anti-SILV antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.
(7 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Sialin/SLC17A5
Antibody
NBP2-20383
Western Blot: SLC17A5 Antibody [NBP2-20383] - Sample (30 ug of whole cell lysate) A: Jurkat 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SLC17A5 Antibody [NBP2-20383] - Sample: HepG2 cells were fixed in -20C 100% MeOH for 5 min. Green: SLC17A5 protein stained by SLC17A5 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: Sialin/SLC17A5 Antibody [NBP2-20383] - Mouse lung diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
CapG Antibody
NBP1-90214
Western Blot: CapG Antibody [NBP1-90214] - Analysis using Anti-CAPG antibody NBP1-90214 (A) shows similar pattern to independent antibody NBP1-90213 (B).
Immunocytochemistry/Immunofluorescence: CapG Antibody [NBP1-90214] - Staining of human cell line A-431 shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CapG Antibody [NBP1-90214] - Staining of human lung, lymph node, skeletal muscle and small intestine using Anti-CAPG antibody (A) NBP1-90214 shows similar protein distribution across tissues to independent antibody NBP1-90215 (B).
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Lipoprotein a
Antibody (4H1)
NBP2-37477
Western Blot: Lipoprotein a Antibody (4H1) [NBP2-37477] - Western blot analysis using LPA mAb against human LPA recombinant protein. (Expected MW is 34.1 kDa)
Immunocytochemistry/Immunofluorescence: Lipoprotein a Antibody (4H1) [NBP2-37477] - Immunofluorescence analysis of HepG2 cells using LPA mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: Lipoprotein a Antibody (4H1) [NBP2-37477] - Analysis of rectum cancer tissues using LPA mouse mAb with DAB staining.
(2 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Apolipoprotein
A-I/ApoA1 Antibody
NBP2-52979
Western Blot: Apolipoprotein A-I/ApoA1 Antibody [NBP2-52979] - Total protein from HepG2 and Hek293 cells was separated on a 4-15% gradient gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-APOA1 in 1% milk, and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: Apolipoprotein A-I/ApoA1 Antibody [NBP2-52979] - HepG2 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-APOA1 at a 1:200 dilution overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Apolipoprotein A-I/ApoA1 Antibody [NBP2-52979] - IHC analysis of a formalin fixed and paraffin embedded tissue section of mouse liver using APOA1 antibody at 1:400 dilution. The antibody generated a weak/mild cytoplasmic signal in hepatocytes with a very strong positivity near the hepatocyte membranes as well as in the inter-cellular spaces.
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
CD55/DAF Antibody
NBP1-85466
CD55/DAF Antibody
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P

Publications for CD55/DAF Antibody (NBP1-85466)(2)

We have publications tested in 3 confirmed species: Human, Mouse, Feline.

We have publications tested in 3 applications: IHC, IHC-P, WB.


Filter By Application
IHC
(1)
IHC-P
(1)
WB
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
Feline
(1)
All Species

Reviews for CD55/DAF Antibody (NBP1-85466) (0)

There are no reviews for CD55/DAF Antibody (NBP1-85466). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD55/DAF Antibody (NBP1-85466) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional CD55/DAF Products

Bioinformatics Tool for CD55/DAF Antibody (NBP1-85466)

Discover related pathways, diseases and genes to CD55/DAF Antibody (NBP1-85466). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD55/DAF Antibody (NBP1-85466)

Discover more about diseases related to CD55/DAF Antibody (NBP1-85466).
 

Pathways for CD55/DAF Antibody (NBP1-85466)

View related products by pathway.

PTMs for CD55/DAF Antibody (NBP1-85466)

Learn more about PTMs related to CD55/DAF Antibody (NBP1-85466).
 

Research Areas for CD55/DAF Antibody (NBP1-85466)

Find related products by research area.

Blogs on CD55/DAF

There are no specific blogs for CD55/DAF, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD55/DAF Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CD55