CD45RC Antibody (3D3)

Images

 
There are currently no images for CD45RC Antibody (H00005788-M12).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3D3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CD45RC Antibody (3D3) Summary

Immunogen
PTPRC (NP_002829.2 390 a.a. - 570 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVKDLQYSTDYTFKAYFHNGDYPGEPFILHHST
Specificity
This product is specific for Human PTPRC monoclonal antibody (M12), clone 3D3 [Gene ID: 5788].
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PTPRC
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD45RC Antibody (3D3)

  • B220
  • CD45 antigen
  • CD45R
  • EC 3.1.3.48
  • L-CA
  • LY5
  • protein tyrosine phosphatase, receptor type, C
  • receptor-type tyrosine-protein phosphatase C
  • T200 glycoprotein
  • T200 leukocyte common antigen
  • T200receptor type, c polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP

Publications for CD45RC Antibody (H00005788-M12) (0)

There are no publications for CD45RC Antibody (H00005788-M12).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD45RC Antibody (H00005788-M12) (0)

There are no reviews for CD45RC Antibody (H00005788-M12). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD45RC Antibody (H00005788-M12) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD45RC Products

CD45RC H00005788-M12

Bioinformatics Tool for CD45RC Antibody (H00005788-M12)

Discover related pathways, diseases and genes to CD45RC Antibody (H00005788-M12). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD45RC Antibody (H00005788-M12)

Discover more about diseases related to CD45RC Antibody (H00005788-M12).
 

Pathways for CD45RC Antibody (H00005788-M12)

View related products by pathway.

PTMs for CD45RC Antibody (H00005788-M12)

Learn more about PTMs related to CD45RC Antibody (H00005788-M12).
 

Research Areas for CD45RC Antibody (H00005788-M12)

Find related products by research area.

Blogs on CD45RC

There are no specific blogs for CD45RC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD45RC Antibody (3D3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPRC
Uniprot