CD45RC Antibody (3D3) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
PTPRC (NP_002829.2, 390 a.a. ~ 570 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVKDLQYSTDYTFKAYFHNGDYPGEPFILHHST |
| Specificity |
This product is specific for Human PTPRC monoclonal antibody (M12), clone 3D3 [Gene ID: 5788]. |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
PTPRC |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CD45RC Antibody (3D3) - Azide and BSA Free
Background
The CD45 family of cell surface glycoprotein antigens exist as a set of isoforms. The patterns of monoclonal antibody recognition of the CD45 phenotypes can be restricted (CD45RA, RB and RC), or broader, such as the CD45 T 200 species. The "restricted" subsets of this group arise as a result of translation of alternatively spliced mRNAs from exons A, B and C (exons 4, 5 and 6), where exons 3-15 encode the extracellular domain of the CD45 molecule. The restricted epitopes are differentially expressed on T and B lymphocytes, including functionally distinct T cells. CD45 (LCA) is a transmembrane phosphotyrosine phosphatase expressed on leucocytes. Myeloid cells do not express the RC isoform.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Rt
Applications: IHC, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Publications for CD45RC Antibody (H00005788-M12) (0)
There are no publications for CD45RC Antibody (H00005788-M12).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD45RC Antibody (H00005788-M12) (0)
There are no reviews for CD45RC Antibody (H00005788-M12).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CD45RC Antibody (H00005788-M12) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CD45RC Products
Research Areas for CD45RC Antibody (H00005788-M12)
Find related products by research area.
|
Blogs on CD45RC