CD43/Sialophorin Antibody - BSA Free

Immunohistochemistry-Paraffin: CD43/Sialophorin Antibody [NBP2-33746] - Staining in human lymph node and cerebral cortex tissues using anti-SPN antibody. Corresponding SPN RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CD43/Sialophorin Antibody [NBP2-33746] - Staining of human lymph node shows high expression.

Immunohistochemistry-Paraffin: CD43/Sialophorin Antibody [NBP2-33746] - Staining of human cerebral cortex shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD43/Sialophorin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CD43/Sialophorin Antibody - BSA Free (NBP2-33746) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CD43/Sialophorin Protein (NBP2-33746PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CD43/Sialophorin Antibody - BSA Free

• CD43 antigen
• CD43
• CD43)
• Galactoglycoprotein
• GALGP
• GPL115
• Leukocyte sialoglycoprotein
• Leukosialin
• LSN
• Ly-48
• sialophorin (gpL115, leukosialin, CD43)
• Sialophorin
• SPN

Background

CD43 is a key glycoprotein of thymocytes and T lymphocytes, which affects the physicochemical properties of the T-cell surface and plays a role in lectin binding. This antibody contains an extended rodlike structure that may protrude above the glycocalyx of the cell, allowing accessibility of multiple glycan chains for binding. During T-cell activation CD43 is actively removed from the T-cell-antigen-presenting cell contact site, thus suggesting CD43's role in negative regulation of the adaptive immune response.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPN
• Uniprot:
  • P16150()