| Description | Novus Biologicals Rabbit CD38 Antibody - BSA Free (NBP1-86010) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This CD38 antibody was developed against Recombinant Protein corresponding to amino acids: AACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CD38 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Theoretical MW | 34.3 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CD38 Antibody (NBP1-86010)Find related products by research area.
|
|
Transferrin and the blood brain barrier Transferrin, an iron binding protein that facilitates iron uptake in cells, is an integral part of a mechanism that may introduce antibody therapies to the central nervous system. Currently, the brain’s ability to take in antibody therapies i... Read full blog post. |
|
Multifunctional CD38 CD38 is a 42 kD type II transmembrane glycoprotein that uses nicotinamide adenine dinucleotide (NAD) as a substrate to form cyclic adenosine diphosphate ribose (cADPR). This novel multifunctional ectoenzyme has both cyclase and hydrolase enzymatic act... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CD38 |