Recombinant Human CD36 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human CD36 GST (N-Term) Protein [H00000948-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human CD36 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-472 of Human CD36

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CD36
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
79.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD36 GST (N-Term) Protein

  • BDPLT10
  • CD36 antigen (collagen type I receptor, thrombospondin receptor)
  • CD36 molecule (thrombospondin receptor)
  • CHDS7
  • cluster determinant 36
  • FAT
  • Fatty acid translocase
  • Glycoprotein IIIb
  • GP3B
  • GP4
  • GPIIIB
  • GPIV
  • leukocyte differentiation antigen CD36
  • PAS IV
  • PAS-4 protein
  • PASIV
  • platelet glycoprotein 4
  • platelet glycoprotein IV
  • SCARB3
  • scavenger receptor class B, member 3

Background

Originally discovered in platelets, cluster of differentiation 36, CD36, (also known as thrombospondin receptor, fatty acid translocase (FAT), platelet membrane glycoprotein IV (GPIV), and scavenger receptor class B, member 3 (SR-B3)) is a plasma membrane glycoprotein belonging to the class B scavenger receptor family (1,2). Human, mouse, and rat CD36 is synthesized as a 472 amino acid (a.a.) protein with a theoretical molecular weight of 53 kDa for the canonical isoform (3). Its domains include a short cytoplasmic tail at the N-terminal and C-terminal and a large extracellular loop flanked on each side by a transmembrane domain. The extracellular domain facilitates the update of fatty acids (FFAs), phospholipids, and cholesterol by forming two hydrophobic cavities, which was first modeled in the CD36 homologue, LIMP-2/ SCARB2 (4).

The expression of CD36 has been reported in platelets, erythrocytes, monocytes, differentiated adipocytes, skeletal muscle, mammary epithelial cells, spleen cells, some skin microdermal endothelial cells, and in cancer. Circulating levels of soluble CD36 (sCD36) has also been reported in chronic inflammatory disease such as type 2 diabetes and chronic kidney disease. CD36 participates in angiogenesis, innate immunity, and the clearance of apoptotic phagocytes. In lipid metabolism, CD36 functions as a macrophage receptor for oxidized LDL and as an adipocyte receptor/transporter for long-chain FFAs. Plasmodium falciparum, the parasite that causes malaria, binds CD36 via PfEMP1 proteins, tethering parasite-infected erythrocytes to endothelial receptors (5). Anti-CD36 isoantibodies have been detected in Type 1 CD36-deficient mothers and is implicated as the cause of fetal/neonatal alloimmune thrombocytopenia (6).

References

1) Febbraio, M., Hajjar, D. P., & Silverstein, R. L. (2001). CD36: a class B scavenger receptor involved in angiogenesis, atherosclerosis, inflammation, and lipid metabolism. The Journal of clinical investigation, 108(6), 785-791. PMID: 11560944

2) Silverstein RL, Febbraio M. (2000) CD36 and atherosclerosis. Curr Opin Lipidol. 2000 11(5):483-91. PMID: 11048891.

3) Endemann G, Stanton LW, Madden KS, Bryant CM, White RT, Protter AA. (1993) CD36 is a receptor for oxidized low density lipoprotein. J Biol Chem. 268(16):11811-6. PMID: 7685021.

4) Wang, J., & Li, Y. (2019). CD36 tango in cancer: signaling pathways and functions. Theranostics, 9(17), 4893-4908. PMID: 31410189

5) Hsieh FL, Turner L, Bolla JR, Robinson CV, Lavstsen T, Higgins MK. (2016) The structural basis for CD36 binding by the malaria parasite. Nat Commun. 7:12837. PMID: 27667267

6) Gruarin P, Ulliers D, Thorne RF, Alessio M. (2000) Methionine 156 in the immunodominant domain of CD36 contributes to define the epitope recognized by the NL07 MoAb. Mol Cell Biochem 214, 115-121. PMID: 11195795.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-104
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PLA, Simple Western, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
DTSP10
Species: Hu
Applications: ELISA
AF796
Species: Mu
Applications: AdBlk, IHC, WB
NB600-636
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
M6000B
Species: Mu
Applications: ELISA
MAB3304
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
AF1797
Species: Mu
Applications: Block, WB
DC140
Species: Hu
Applications: ELISA
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-16708
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
H00000948-P02
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for CD36 Full Length Recombinant Protein (H00000948-P02) (0)

There are no publications for CD36 Full Length Recombinant Protein (H00000948-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD36 Full Length Recombinant Protein (H00000948-P02) (0)

There are no reviews for CD36 Full Length Recombinant Protein (H00000948-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD36 Full Length Recombinant Protein (H00000948-P02). (Showing 1 - 1 of 1 FAQ).

  1. We bought this protein and are wondering if the GST tag can be removed?
    • This protein is tagged with a GST tag at the N-terminus. If you want to get rid of the tag follow our GST Tag Removal Protocol.

Additional CD36 Products

Research Areas for CD36 Full Length Recombinant Protein (H00000948-P02)

Find related products by research area.

Blogs on CD36.

The affects of Perilipin 2 on diet and metabolism
Perilipin 2 belongs to the Perilipin family, which consists of proteins that coat intracellular lipid storage droplets. Perilipin 2 in particular is involved in lipid globule surface membrane composition, and has also been implicated in the develo...  Read full blog post.

Scavenger's Helper - SR-BI (scavenger receptor class B member 1, SCARB1)
SR-B1 belongs to the CD36 scavenger receptor family and serves as a receptor for several ligands including phospholipids, cholesterol ester, lipoproteins, phosphatidylserine, and caveolae localized HDL. It is expressed in endothelial cells, macrophage...  Read full blog post.

How do Lipase A and the CD36 Antibody Relate to Each Other
Obesity, diabetes and metabolic disorders are dramatically on the increase, linked to disorders such as heart disease, stroke and cancer. To combat this, research groups are studying metabolism at both a cellular and a systemic level. Although we at N...  Read full blog post.

ABCA1 Mutations: A Risk Factor in Atherosclerosis Related Strokes
The ATP Binding Cassette Transporter (ABCA1) gene encodes the cholesterol regulatory efflux protein, which plays a key role in lipid metabolism. ABCA1 antibody products are an important part of any antibody catalog covering atherosclerosis disease res...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD36 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CD36