CD3 zeta Antibody - BSA Free

Immunohistochemistry-Paraffin: CD3 zeta Antibody [NBP1-85750] - Analysis in human lymph node and pancreas tissues using NBP1-85750 antibody. Corresponding CD247 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CD3 zeta Antibody [NBP1-85750] - Staining of human Pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: CD3 zeta Antibody [NBP1-85750] - Staining of human Cerebral cortex shows no positivity in neuronal cells as expected.

Immunohistochemistry-Paraffin: CD3 zeta Antibody [NBP1-85750] - Staining of human Lymph node shows strong membranous positivity in germinal and non-germinal center cells.

Immunohistochemistry-Paraffin: CD3 zeta Antibody [NBP1-85750] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.

Analysis in human cell line MOLT-4.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD3 zeta Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CD3 zeta Antibody - BSA Free (NBP1-85750) is a polyclonal antibody validated for use in IHC and WB. Anti-CD3 zeta Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD247
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CD3 zeta Protein (NBP1-85750PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (89%). Reactivity reported in scientific literature (PMID: 23977094)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CD3 zeta Antibody - BSA Free

• CD247 antigen
• CD247 antigen, zeta subunit
• CD247 molecule
• CD247
• CD3 zeta
• CD3H
• CD3Q
• CD3z antigen, zeta polypeptide (TiT3 complex)
• CD3Z
• CD3ZT-cell receptor T3 zeta chain
• IMD25
• T3Z
• T-cell antigen receptor complex, zeta subunit of CD3
• T-cell surface glycoprotein CD3 zeta chain
• TCR Zeta Chain
• TCRZCD3-ZETA

Background

CD3 (Cluster of Differentiation 3) is a complex of proteins that associates directly with the T cell antigen receptor (TCR). Antigen binding to the TCR leads to IL-2 secretion via activation of a tyrosine phosphorylation pathway and a phospholipase C (PLC) pathway, in turn activating protein kinase C. CD3 is composed of five invariant polypeptide chains that associate to form three dimers. The five invariant chains of CD3 are labeled gamma, delta, epsilon, zeta, and eta. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Loss of the zeta chain results in the synthesis of unstable TCRs. A decrease of CD3 zeta has been described in T cells from patients with cancer, lupus and chronic infectious diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CD3 zeta Antibody (NBP1-85750)(1)

Publication using NBP1-85750

• Grundy S, Plumb J, Lea S et al. Down Regulation of T Cell Receptor Expression in COPD Pulmonary CD8 Cells. PLoS One 2013-01-01 [PMID: 23977094]

Bioinformatics

• Gene Symbol: CD247