CD3 zeta Antibody - Azide and BSA Free

Western Blot: CD3 zeta Antibody [H00000919-D01P] - Analysis of CD247 expression in rat brain.

Western Blot: CD3 zeta Antibody [H00000919-D01P] - Analysis of CD247 expression in IMR-32.

Western Blot: CD3 zeta Antibody [H00000919-D01P] - Analysis of CD247 expression in Raw 264.7.

Western Blot: CD3 zeta Antibody [H00000919-D01P] - Analysis of CD247 expression in mouse kidney.

Western Blot: CD3 zeta Antibody [H00000919-D01P] - Analysis of CD247 expression in mouse brain.

Western Blot: CD3 zeta Antibody [H00000919-D01P] - Analysis of CD247 expression in transfected 293T cell line by CD247 polyclonal antibody.Lane 1: CD247 transfected lysate(18.70 KDa).Lane 2: Non-transfected lysate.

Proximity Ligation Assay: CD3 zeta Antibody [H00000919-D01P] - Analysis of protein-protein interactions between CD247 and CD3E. HeLa cells were stained with anti-CD247 rabbit purified polyclonal 1:1200 and anti-CD3E mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

• Reactivity: Hu, Mu, Rt
• Applications: WB, Func
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CD3 zeta Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: CD247 (NP_932170.1, 1 a.a. - 164 a.a.) full-length human protein. MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
• Specificity: CD247 - CD247 molecule,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD247
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Proximity Ligation Assay
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD3 zeta Antibody - Azide and BSA Free

• CD247 antigen
• CD247 antigen, zeta subunit
• CD247 molecule
• CD247
• CD3 zeta
• CD3H
• CD3Q
• CD3z antigen, zeta polypeptide (TiT3 complex)
• CD3Z
• CD3ZT-cell receptor T3 zeta chain
• IMD25
• T3Z
• T-cell antigen receptor complex, zeta subunit of CD3
• T-cell surface glycoprotein CD3 zeta chain
• TCR Zeta Chain
• TCRZCD3-ZETA

Background

CD3 (Cluster of Differentiation 3) is a complex of proteins that associates directly with the T cell antigen receptor (TCR). Antigen binding to the TCR leads to IL-2 secretion via activation of a tyrosine phosphorylation pathway and a phospholipase C (PLC) pathway, in turn activating protein kinase C. CD3 is composed of five invariant polypeptide chains that associate to form three dimers. The five invariant chains of CD3 are labeled gamma, delta, epsilon, zeta, and eta. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Loss of the zeta chain results in the synthesis of unstable TCRs. A decrease of CD3 zeta has been described in T cells from patients with cancer, lupus and chronic infectious diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD247
• Entrez:
  • 919(Human)
• Uniprot:
  • NP_932170.1(Human)