CD3 zeta Antibody (1T5R7)

Western Blot: CD3 zeta Antibody (1T5R7) [NBP3-15349] - Western blot analysis of extracts of Jurkat cells, using CD3 zeta Rabbit mAb (NBP3-15349) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.

Immunohistochemistry: CD3 zeta Antibody (1T5R7) [CD3 zeta] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using CD3 zeta Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: CD3 zeta Antibody (1T5R7) [CD3 zeta] - Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using CD3 zeta Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Flow Cytometry: CD3 zeta Antibody (1T5R7) [CD3 zeta] - Flow cytometry:1X10^6 Raji cells (negative control,left) and Jurkat cells were intracellularly-stained with CD3 zeta Rabbit mAb or Rabbit IgG isotype control ,followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control .

• Reactivity: Hu
• Applications: WB, ELISA, Flow, IHC
• Clone: 1T5R7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CD3 zeta Antibody (1T5R7) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 65-164 of human CD3 zeta (P20963). QQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CD247
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Flow Cytometry 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:1000 - 1:2000
• Theoretical MW: 19 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CD3 zeta Antibody (1T5R7)

• CD247 antigen
• CD247 antigen, zeta subunit
• CD247 molecule
• CD247
• CD3 zeta
• CD3H
• CD3Q
• CD3z antigen, zeta polypeptide (TiT3 complex)
• CD3Z
• CD3ZT-cell receptor T3 zeta chain
• IMD25
• T3Z
• T-cell antigen receptor complex, zeta subunit of CD3
• T-cell surface glycoprotein CD3 zeta chain
• TCR Zeta Chain
• TCRZCD3-ZETA

Background

CD3 (Cluster of Differentiation 3) is a complex of proteins that associates directly with the T cell antigen receptor (TCR). Antigen binding to the TCR leads to IL-2 secretion via activation of a tyrosine phosphorylation pathway and a phospholipase C (PLC) pathway, in turn activating protein kinase C. CD3 is composed of five invariant polypeptide chains that associate to form three dimers. The five invariant chains of CD3 are labeled gamma, delta, epsilon, zeta, and eta. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Loss of the zeta chain results in the synthesis of unstable TCRs. A decrease of CD3 zeta has been described in T cells from patients with cancer, lupus and chronic infectious diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD247