CD27/TNFRSF7 Antibody - BSA Free Summary
| Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein CD27/TNFRSF7 using the following amino acid sequence: YWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIPGVSFSPDHHTRPHCESCRHCNSGLLVRNCTITANAECA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CD27 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
- Western Blot 0.04-0.4 µg/ml
|
| Application Notes |
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments. |
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CD27/TNFRSF7 Antibody - BSA Free
Background
CD27, also referred to as tumor necrosis factor receptor superfamily, member 7 (TNFRSF7), is a type I transmembrane glycoprotein that functions as a co-stimulatory T cell receptor and is expressed on the surface of T cells, natural killer (NK) cells, and B cells (1,2). The human CD27 protein is 260 amino acids (aa) in length and consists of a 19 aa signal sequence, 172 aa extracellular domain (ECD) containing three characteristic cysteine-rich domains (CRDs), a 21 aa helical transmembrane region, and a 48 aa cytoplasmic tail domain (3,4). The CD27 protein has a theoretical molecular weight (MW) of 29 kDa, but is typically is closer to 50-55 kDa due to N-linked and O-linked glycosylation (3). Mouse CD27 cDNA encodes a 250 aa protein with a theoretical molecular weight of 28 kDa (5). Human CD27 shares ~64% aa sequence identity with mouse CD27 protein.
Membrane-bound CD27 is expressed as a disulfide-linked homodimer (3). CD27 binds to the ligand CD70, a transmembrane glycoprotein that is transiently expressed on activated immune cells such as antigen presenting cells (APCs), dendritic cells (DCs), NK cells, B cells, and T cells (1,2,6,7). The receptor-ligand binding interaction leads to NFkappaB and c-Jun pathway activation which promotes immune stimulation and activation and survival of CD4+ T cells, CD8+ T cells, memory T cells, and NK cells (2,6,7). Both CD27 and CD70 are often abnormally expressed or dysregulated on malignant and cancer cells leading to immune evasion and tumor progression (7). CD27 has become a target of interest of immunotherapies for viral infections, autoimmune disease, and cancer (2). Varlilumab, an agonistic CD27 monoclonal antibody (mAB), has entered clinical trials for the treatment of hematological and solid tumor cancers (1,6). Additional clinical trials are in process that combine varlilumab with other immune checkpoint inhibitors like the programmed cell death protein-1 (PD-1) blocking mAb nivolumab (1,2). Initial results are promising, suggesting that targeting CD27, especially in combination with other therapeutics, may be a promising and effective immunotherapy for a variety of pathologies (1,2,6).
References
1. Starzer AM, Berghoff AS. New emerging targets in cancer immunotherapy: CD27 (TNFRSF7). ESMO Open. 2020;4(Suppl 3):e000629. https://doi.org/10.1136/esmoopen-2019-000629
2. Grant EJ, Nussing S, Sant S, Clemens EB, Kedzierska K. The role of CD27 in anti-viral T-cell immunity. Curr Opin Virol. 2017;22:77-88. https://doi.org/10.1016/j.coviro.2016.12.001
3. Buchan SL, Rogel A, Al-Shamkhani A. The immunobiology of CD27 and OX40 and their potential as targets for cancer immunotherapy. Blood. 2018;131(1):39-48. https://10.1182/blood-2017-07-741025
4. Uniprot (P26842)
5. Uniprot (P41272)
6. van de Ven K, Borst J. Targeting the T-cell co-stimulatory CD27/CD70 pathway in cancer immunotherapy: rationale and potential. Immunotherapy. 2015;7(6):655-667. https://doi.org/10.2217/imt.15.32
7. Flieswasser T, Van den Eynde A, Van Audenaerde J, et al. The CD70-CD27 axis in oncology: the new kids on the block. J Exp Clin Cancer Res. 2022;41(1):12. https://doi.org/10.1186/s13046-021-02215-y
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: Flow
Species: Hu
Applications: AgAct, ICC, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Mu
Applications: ELISA
Publications for CD27/TNFRSF7 Antibody (NBP3-24724) (0)
There are no publications for CD27/TNFRSF7 Antibody (NBP3-24724).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD27/TNFRSF7 Antibody (NBP3-24724) (0)
There are no reviews for CD27/TNFRSF7 Antibody (NBP3-24724).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CD27/TNFRSF7 Antibody (NBP3-24724) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CD27/TNFRSF7 Products
Research Areas for CD27/TNFRSF7 Antibody (NBP3-24724)
Find related products by research area.
|
Blogs on CD27/TNFRSF7