CD25/IL-2R alpha Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL2RA. Source: E. coli
Amino Acid Sequence: YKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
IL2RA |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38730. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for CD25/IL-2R alpha Recombinant Protein Antigen
Background
The interleukin 2 (IL2) receptor alpha (IL2RA) and beta (IL2RB) chains, together with the common gamma chain (IL2RG), constitute the high-affinity IL2 receptor. Homodimeric alpha chains (IL2RA) result in low-affinity receptor, while homodimeric beta (IL2RB) chains produce a medium-affinity receptor. Normally an integral-membrane protein, soluble IL2RA has been isolated and determined to result from extracellular proteolyisis. Alternately-spliced IL2RA mRNAs have been isolated, but the significance of each is presently unknown. Mutations in this gene are associated with interleukin 2 receptor alpha deficiency.(provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, PLA, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Publications for CD25/IL-2R alpha Recombinant Protein Antigen (NBP2-38730PEP) (0)
There are no publications for CD25/IL-2R alpha Recombinant Protein Antigen (NBP2-38730PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD25/IL-2R alpha Recombinant Protein Antigen (NBP2-38730PEP) (0)
There are no reviews for CD25/IL-2R alpha Recombinant Protein Antigen (NBP2-38730PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for CD25/IL-2R alpha Recombinant Protein Antigen (NBP2-38730PEP) (0)
Additional CD25/IL-2R alpha Products
Research Areas for CD25/IL-2R alpha Recombinant Protein Antigen (NBP2-38730PEP)
Find related products by research area.
|
Blogs on CD25/IL-2R alpha