CD20 Antibody

Images

 
Western Blot: CD20 Antibody [NBP1-90051] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: CD20 Antibody [NBP1-90051] - Staining of human spleen shows strong cytoplasmic positivity in cells of white pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD20 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MS4A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD20 Recombinant Protein Antigen (NBP1-90051PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD20 Antibody

  • B1
  • B-lymphocyte antigen CD20
  • B-lymphocyte cell-surface antigen B1
  • B-lymphocyte surface antigen B1
  • Bp35
  • Bp35MGC3969
  • CD20 antigen
  • CD20 receptor
  • CD20
  • CD20S7
  • CVID5
  • LEU-16
  • Leukocyte surface antigen Leu-16
  • Ly-44
  • Membrane-spanning 4-domains subfamily A member 1
  • membrane-spanning 4-domains, subfamily A, member 1
  • MS4A1
  • MS4A2
  • S7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11228
Species: Hu
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-02690
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CD20 Antibody (NBP1-90051) (0)

There are no publications for CD20 Antibody (NBP1-90051).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD20 Antibody (NBP1-90051) (0)

There are no reviews for CD20 Antibody (NBP1-90051). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD20 Antibody (NBP1-90051) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD20 Products

Bioinformatics Tool for CD20 Antibody (NBP1-90051)

Discover related pathways, diseases and genes to CD20 Antibody (NBP1-90051). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD20 Antibody (NBP1-90051)

Discover more about diseases related to CD20 Antibody (NBP1-90051).
 

Pathways for CD20 Antibody (NBP1-90051)

View related products by pathway.

PTMs for CD20 Antibody (NBP1-90051)

Learn more about PTMs related to CD20 Antibody (NBP1-90051).
 

Research Areas for CD20 Antibody (NBP1-90051)

Find related products by research area.

Blogs on CD20.

CD20 (Cluster of differentiation 20, Membrane-spanning 4-domains subfamily A member 1 (MS4A1), CVID5, B-lymphocyte surface antigen B1)
CD20 is a human B-lymphocyte surface molecule that spans the membrane four times and is expressed on both normal and malignant cells. The CD20 antigen displays a unique expression pattern among hematopoietic cells - it is present on human pre B-ly...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MS4A1
Entrez