CD1d Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CD1d Antibody [NBP2-57561] - Staining of human cell line HEK 293 shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD1d Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPW
Specificity
Specificity of human CD1d antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD1D
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CD1d Recombinant Protein Antigen (NBP2-57561PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CD1d Antibody

  • antigen-presenting glycoprotein CD1d
  • CD1A
  • CD1d antigen
  • CD1D antigen, d polypeptide
  • CD1d molecule
  • CD1d
  • differentiation antigen CD1-alpha-3
  • HMC class I antigen-like glycoprotein CD1D
  • MGC34622
  • R3
  • R3G1
  • T-cell surface glycoprotein CD1d
  • thymocyte antigen CD1D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65315
Species: Bv, Ca, Eq, Gt, Sh
Applications: Flow, IHC, IHC-Fr, IP
NBP2-46123
Species: Hu
Applications: WB, IHC, IHC-P, IF
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-21792
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46198
Species: Hu
Applications: WB, IHC
6507-IL/CF
Species: Hu
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF4884
Species: Mu
Applications: WB
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP1-80306
Species: Hu, Av
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-57561
Species: Hu
Applications: ICC/IF

Publications for CD1d Antibody (NBP2-57561) (0)

There are no publications for CD1d Antibody (NBP2-57561).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD1d Antibody (NBP2-57561) (0)

There are no reviews for CD1d Antibody (NBP2-57561). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CD1d Antibody (NBP2-57561). (Showing 1 - 1 of 1 FAQ).

  1. Do you have an antibody for CD1d that works well on formalin fixed paraffin embedded tissue (specifically for liver tissue)?
    • We do have a CD1d antibody that has been verified in paraffin-embedded tissue sections. The catalog number is NBP1-43461.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CD1d Products

Bioinformatics Tool for CD1d Antibody (NBP2-57561)

Discover related pathways, diseases and genes to CD1d Antibody (NBP2-57561). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD1d Antibody (NBP2-57561)

Discover more about diseases related to CD1d Antibody (NBP2-57561).
 

Pathways for CD1d Antibody (NBP2-57561)

View related products by pathway.

PTMs for CD1d Antibody (NBP2-57561)

Learn more about PTMs related to CD1d Antibody (NBP2-57561).

Blogs on CD1d

There are no specific blogs for CD1d, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD1d Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD1D