CD161 Antibody


Immunohistochemistry-Paraffin: CD161 Antibody [NBP1-88130] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

CD161 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIH
Specificity of human CD161 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD161 Protein (NBP1-88130PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CD161 Antibody

  • CD161 antigen
  • CD161
  • CLEC5B
  • CLEC5BC-type lectin domain family 5 member B
  • HNKR-P1a
  • killer cell lectin-like receptor subfamily B member 1
  • killer cell lectin-like receptor subfamily B, member 1
  • KLRB1
  • Ly59
  • Natural killer cell surface protein P1A
  • NKR
  • NKRP1
  • NKR-P1
  • NKRP1A
  • NKR-P1AMGC138614


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, Block, CyTOF-ready
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
Species: Hu
Applications: Flow, CyTOF-ready

Publications for CD161 Antibody (NBP1-88130) (0)

There are no publications for CD161 Antibody (NBP1-88130).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD161 Antibody (NBP1-88130) (0)

There are no reviews for CD161 Antibody (NBP1-88130). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD161 Antibody (NBP1-88130) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CD161 Products

Bioinformatics Tool for CD161 Antibody (NBP1-88130)

Discover related pathways, diseases and genes to CD161 Antibody (NBP1-88130). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD161 Antibody (NBP1-88130)

Discover more about diseases related to CD161 Antibody (NBP1-88130).

Pathways for CD161 Antibody (NBP1-88130)

View related products by pathway.

PTMs for CD161 Antibody (NBP1-88130)

Learn more about PTMs related to CD161 Antibody (NBP1-88130).

Research Areas for CD161 Antibody (NBP1-88130)

Find related products by research area.

Blogs on CD161

There are no specific blogs for CD161, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CD161 Antibody and receive a gift card or discount.


Gene Symbol KLRB1