CD161 Antibody

Images

 
Immunohistochemistry-Paraffin: CD161 Antibody [NBP1-88130] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD161 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLRB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CD161 Protein (NBP1-88130PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD161 Antibody

  • CD161 antigen
  • CD161
  • CLEC5B
  • CLEC5BC-type lectin domain family 5 member B
  • HNKR-P1a
  • killer cell lectin-like receptor subfamily B member 1
  • killer cell lectin-like receptor subfamily B, member 1
  • KLRB1
  • Ly59
  • Natural killer cell surface protein P1A
  • NKR
  • NKRP1
  • NKR-P1
  • NKRP1A
  • NKR-P1AMGC138614
  • NKRP1ANKR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1058
Species: Hu
Applications: Flow, Block, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB1059
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00029121-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready

Publications for CD161 Antibody (NBP1-88130) (0)

There are no publications for CD161 Antibody (NBP1-88130).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD161 Antibody (NBP1-88130) (0)

There are no reviews for CD161 Antibody (NBP1-88130). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CD161 Antibody (NBP1-88130) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD161 Products

Bioinformatics Tool for CD161 Antibody (NBP1-88130)

Discover related pathways, diseases and genes to CD161 Antibody (NBP1-88130). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD161 Antibody (NBP1-88130)

Discover more about diseases related to CD161 Antibody (NBP1-88130).
 

Pathways for CD161 Antibody (NBP1-88130)

View related products by pathway.

PTMs for CD161 Antibody (NBP1-88130)

Learn more about PTMs related to CD161 Antibody (NBP1-88130).
 

Research Areas for CD161 Antibody (NBP1-88130)

Find related products by research area.

Blogs on CD161

There are no specific blogs for CD161, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD161 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLRB1
Entrez
Uniprot