CCR9 Antibody

Western Blot: CCR9 Antibody [H00010803-D01P] - Analysis of CCR9 expression in transfected 293T cell line by CCR9 polyclonal antibody.Lane 1: CCR9 transfected lysate(42.00 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

CCR9 Antibody Summary

• Immunogen: CCR9 (NP_112477.1, 1 a.a. - 369 a.a.) full-length human protein. MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL
• Specificity: Reacts with chemokine (C-C motif) receptor 9.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCR9
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCR9 Antibody

• C-C chemokine receptor type 9
• C-C CKR-9
• CC-CKR-9
• CCR9
• CCR-9
• CD199
• CDw199 antigen
• CDw199
• chemokine (C-C motif) receptor 9
• G protein-coupled receptor 28
• GPR28
• GPR-9-6G-protein coupled receptor 28

Background

The protein encoded by this gene is a member of the beta chemokine receptor family. It is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are key regulators of the thymocytes migration and maturation in normal and inflammation conditions. The specific ligand of this receptor is CCL25. It has been found that this gene is differentially expressed by T lymphocytes of small intestine and colon, suggested a role in the thymocytes recruitment and development that may permit functional specialization of immune responses in different segment of the gastrointestinal tract. This gene is mapped to the chemokine receptor gene cluster region. Two alternatively spliced transcript variants have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCR9
• Entrez:
  • 10803(Human)
• Uniprot:
  • NP_112477.1(Human)