CCR8 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: MDYTLDLSVTTVTDYYYPDIFSSPCDGELIQTNGKLLL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CCR8 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:5000 - 1:10000
- Immunohistochemistry-Paraffin 1:5000 - 1:10000
|
| Application Notes |
Recommended conditions for IHC,Retrieval method: HIER pH6 |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Protein A purified |
Alternate Names for CCR8 Antibody
Background
CKR8/CCR8, or C-C chemokine receptor type 8, is a G protein-coupled, seven-transmembrane domain receptor protein. Chemokines are key molecules in directing leukocyte migration toward sites of inflammation. The human C-C chemokine I-309 is a monocyte chemoattractant and inhibits apoptosis in thymic cell lines. It has been found that CKR8/CCR8 is a receptor for chemokines SCYA1/I-309, SCYA4/MIP-1-beta, and SCYA17/TARC (1-3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Mu
Applications: BA
Species: Hu
Applications: IHC
Publications for CCR8 Antibody (NBP2-68645) (0)
There are no publications for CCR8 Antibody (NBP2-68645).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CCR8 Antibody (NBP2-68645) (0)
There are no reviews for CCR8 Antibody (NBP2-68645).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for CCR8 Antibody (NBP2-68645) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CCR8 Products
Research Areas for CCR8 Antibody (NBP2-68645)
Find related products by research area.
|
Blogs on CCR8