CCR8 Antibody

Immunohistochemistry-Paraffin: CCR8 Antibody [NBP2-68645] - Staining of human skeletal muscle shows not postivity in myocytes as expected.

Immunohistochemistry-Paraffin: CCR8 Antibody [NBP2-68645] - Staining of human thymus shows strong cytoplasmic positivity in cortical cells.

Immunohistochemistry-Paraffin: CCR8 Antibody [NBP2-68645] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: CCR8 Antibody [NBP2-68645] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Discontinued

CCR8 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MDYTLDLSVTTVTDYYYPDIFSSPCDGELIQTNGKLLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCR8
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for CCR8 Antibody

• CC chemokine receptor 8
• C-C CKR-8
• CC-chemokine receptor chemr1
• CC-CKR-8
• CCR8
• CCR-8
• CD198
• CDw198 antigen
• CDw198
• chemokine (C-C motif) receptor 8
• chemokine (C-C) receptor 8
• chemokine (C-C) receptor-like 2
• Chemokine receptor-like 1
• ChemR1
• CKRL1
• CKR-L1
• CKRL1MGC129966
• CMKBR8MGC129973
• CMKBRL2C-C chemokine receptor type 8
• CY6
• GPRCL1
• GPRCY6
• GPR-CY6
• TER-1
• TER1CC chemokine receptor CHEMR1

Background

CKR8/CCR8, or C-C chemokine receptor type 8, is a G protein-coupled, seven-transmembrane domain receptor protein. Chemokines are key molecules in directing leukocyte migration toward sites of inflammation. The human C-C chemokine I-309 is a monocyte chemoattractant and inhibits apoptosis in thymic cell lines. It has been found that CKR8/CCR8 is a receptor for chemokines SCYA1/I-309, SCYA4/MIP-1-beta, and SCYA17/TARC (1-3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCR8