CCL3L1/LD78 beta Antibody - BSA Free

Western Blot: CCL3L1/LD78 beta Antibody [NBP3-05563] - Western blot analysis of extracts of B-cell cells, using CCL3L1/LD78 beta antibody (NBP3-05563) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 60s.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCL3L1/LD78 beta Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-93 of human CCL3L1/LD78 beta (NP_066286.1). APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCL3L1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 10 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CCL3L1/LD78 beta Antibody - BSA Free

• C-C motif chemokine 3-like 1
• CCL3L3
• chemokine (C-C motif) ligand 3-like 1
• D17S1718
• G0/G1 switch regulatory protein 19-2
• G0S19-2LD78
• LD78BETA
• LD78-beta(1-70)
• MGC104178
• MGC12815
• MGC182017
• MIP1AP
• PAT 464.2
• SCYA3L
• SCYA3L1464.2
• small inducible cytokine A3-like 1
• Small-inducible cytokine A3-like 1
• Tonsillar lymphocyte LD78 beta protein

Background

Macrophage inflammatory protein-1 is a so-called monokine that is involved in the acute inflammatory state in the recruitment and activation of polymorphonuclear leukocytes (Wolpe et al., 1988). Sherry et al. (1988) demonstrated 2 protein components of MIP1, called by them alpha and beta.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCL3L1