Recombinant Human CCL16/HCC-4/LEC Protein

Images

 
There are currently no images for CCL16/HCC-4/LEC Recombinant Protein (NBP1-99336).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications PAGE
Concentration
Lyoph

Order Details

Recombinant Human CCL16/HCC-4/LEC Protein Summary

Description
Recombinant protein for Human CCL16/HCC-4/LEC

Source:E. coli
Amino Acid Sequence:(O15467) - QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNP NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Preparation
Method
Determined to be >97% pure by SDS-PAGE
Source
E. coli
Protein/Peptide Type
Recombinant Protein
Gene
CCL16
Purity
>95%, by SDS-PAGE

Applications/Dilutions

Theoretical MW
11.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20 to -80C. Avoid freeze-thaw cycles.
Buffer
Lyophilized from a filtered solution containing 20 mM sodium phosphate buffer, pH 7.4 and 150 mM NaCl.
Concentration
Lyoph
Purity
>95%, by SDS-PAGE
Reconstitution Instructions
Reconstitute in sterile ddH2O to a concentration> 100 ug/ml. This solution can then be diluted into other aqueous buffers.

Alternate Names for Recombinant Human CCL16/HCC-4/LEC Protein

  • C-C motif chemokine 16
  • CCL16
  • chemokine (C-C motif) ligand 16
  • Chemokine CC-4
  • Chemokine LEC
  • CKb12
  • HCC4
  • HCC-4
  • HCC-4Liver-expressed chemokine
  • LCC-1Lymphocyte and monocyte chemoattractant
  • LEC
  • liver CC chemokine-1
  • LMC
  • LMCSmall-inducible cytokine A16
  • monotactin-1
  • Mtn-1
  • NCC-4
  • NCC4IL-10-inducible chemokine
  • NCC-4ILINCK
  • new CC chemokine 4
  • SCYA16MGC117051
  • SCYL4
  • small inducible cytokine subfamily A (Cys-Cys), member 16

Background

Human CCL16, is a novel CC chemokine recognized by bioinformatics. NCC-4 cDNA encodes a 120 amino acids along with a 23 amino acids signal peptide that is cleaved to generate 97 amino acid protein. HCC4 is vaguely related to other CC chemokines (< 30% homology). Among CC chemokines, CCL-16 has the largest similarity to HCC-1. 2 potential polyadenylation signals are present on the human HCC-4 gene, and as a result, 2 transcripts containing roughly 1,500 base pairs and 500 base pairs have been detected. HCC-4 is expressed weakly by some lymphocytes, including NK cells, T cells, and some T cell clones. The expression of HCC-4 in monocytes is greatly upregulated in the presence of IL-10. CCL16 shows chemotactic activity for lymphocytes and monocytes rather than to neutrophils. NCC-4 has potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. CCL16 demonstrates chemotactic activity for monocytes and thp-1 monocytes, rather than for resting lymphocytes and neutrophils. HCC-4 induces a calcium flux in thp-1 cells that desensitized prior to the expression of rantes. CCL16 Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 97 amino acids and having a molecular mass of 11.2 kDa. The CCL16 is purified by proprietary chromatographic techniques

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB363
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB145
Species: Hu
Applications: Flow, CyTOF-ready
NB600-1015
Species: Mu, Hu(-)
Applications: WB, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
AF2125
Species: Mu
Applications: WB, IHC
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB3241
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
MAB1429
Species: Hu
Applications: Neut

Publications for CCL16/HCC-4/LEC Recombinant Protein (NBP1-99336) (0)

There are no publications for CCL16/HCC-4/LEC Recombinant Protein (NBP1-99336).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCL16/HCC-4/LEC Recombinant Protein (NBP1-99336) (0)

There are no reviews for CCL16/HCC-4/LEC Recombinant Protein (NBP1-99336). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for CCL16/HCC-4/LEC Recombinant Protein (NBP1-99336) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for CCL16/HCC-4/LEC Recombinant Protein (NBP1-99336)

Discover related pathways, diseases and genes to CCL16/HCC-4/LEC Recombinant Protein (NBP1-99336). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCL16/HCC-4/LEC Recombinant Protein (NBP1-99336)

Discover more about diseases related to CCL16/HCC-4/LEC Recombinant Protein (NBP1-99336).
 

Pathways for CCL16/HCC-4/LEC Recombinant Protein (NBP1-99336)

View related products by pathway.

PTMs for CCL16/HCC-4/LEC Recombinant Protein (NBP1-99336)

Learn more about PTMs related to CCL16/HCC-4/LEC Recombinant Protein (NBP1-99336).

Blogs on CCL16/HCC-4/LEC

There are no specific blogs for CCL16/HCC-4/LEC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CCL16/HCC-4/LEC Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CCL16
Entrez