Recombinant Human CCL16/HCC-4/LEC Protein

Product Discontinued

Recombinant Human CCL16/HCC-4/LEC Protein Summary

• Description: Recombinant protein for Human CCL16/HCC-4/LEC
  
  

  Source:E. coli
  Amino Acid Sequence:(O15467) - QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNP NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

• Preparation Method: Determined to be >97% pure by SDS-PAGE
• Source: E. coli
• Protein/Peptide Type: Recombinant Protein
• Gene: CCL16
• Purity: >97%, by SDS-PAGE

Applications/Dilutions

• Dilutions:
  • SDS-Page
• Theoretical MW: 11.2 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C.
• Buffer: Lyophilized from 20 mM sodium phosphate buffer (pH 7.4), 150 mM NaCl.
• Concentration: Lyoph
• Purity: >97%, by SDS-PAGE
• Reconstitution Instructions: Reconstitute in sterile ddH2O to >100 ug/ml. This solution can then be diluted into other aqueous buffers.

Alternate Names for Recombinant Human CCL16/HCC-4/LEC Protein

• C-C motif chemokine 16
• CCL16
• chemokine (C-C motif) ligand 16
• Chemokine CC-4
• Chemokine LEC
• CKb12
• HCC4
• HCC-4
• HCC-4Liver-expressed chemokine
• LCC-1Lymphocyte and monocyte chemoattractant
• LEC
• liver CC chemokine-1
• LMC
• LMCSmall-inducible cytokine A16
• monotactin-1
• Mtn-1
• NCC-4
• NCC4IL-10-inducible chemokine
• NCC-4ILINCK
• new CC chemokine 4
• SCYA16MGC117051
• SCYL4
• small inducible cytokine subfamily A (Cys-Cys), member 16

Background

Human CCL16, is a novel CC chemokine recognized by bioinformatics. NCC-4 cDNA encodes a 120 amino acids along with a 23 amino acids signal peptide that is cleaved to generate 97 amino acid protein. HCC4 is vaguely related to other CC chemokines (< 30% homology). Among CC chemokines, CCL-16 has the largest similarity to HCC-1. 2 potential polyadenylation signals are present on the human HCC-4 gene, and as a result, 2 transcripts containing roughly 1,500 base pairs and 500 base pairs have been detected. HCC-4 is expressed weakly by some lymphocytes, including NK cells, T cells, and some T cell clones. The expression of HCC-4 in monocytes is greatly upregulated in the presence of IL-10. CCL16 shows chemotactic activity for lymphocytes and monocytes rather than to neutrophils. NCC-4 has potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. CCL16 demonstrates chemotactic activity for monocytes and thp-1 monocytes, rather than for resting lymphocytes and neutrophils. HCC-4 induces a calcium flux in thp-1 cells that desensitized prior to the expression of rantes. CCL16 Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 97 amino acids and having a molecular mass of 11.2 kDa. The CCL16 is purified by proprietary chromatographic techniques

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CCL16