CCL1/I-309/TCA-3 Antibody (4E4) - Azide and BSA Free

Sandwich ELISA: CCL1/I-309/TCA-3 Antibody (4E4) [H00006346-M02] - Detection limit for recombinant GST tagged CCL1 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 4E4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CCL1/I-309/TCA-3 Antibody (4E4) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CCL1 (NP_002972, 24 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
• Specificity: CCL1 - chemokine (C-C motif) ligand 1 (4E4)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CCL1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCL1/I-309/TCA-3 Antibody (4E4) - Azide and BSA Free

• C-C motif chemokine 1
• CCL1
• chemokine (C-C motif) ligand 1
• I-309
• inflammatory cytokine I-309
• P500
• SCYA1
• SCYA1Small-inducible cytokine A1
• SCYA2
• SISe
• small inducible cytokine A1 (I-309, homologous to mouse Tca-3)
• T lymphocyte-secreted protein I-309
• TCA3
• TCA-3

Background

This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine receptor CCR8. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCL1
• Entrez:
  • 6346(Human)
• Uniprot:
  • NP_002972(Human)