CCDC85B Antibody

Images

 
Immunohistochemistry-Paraffin: CCDC85B Antibody [NBP2-14457] Staining of human kidney shows strong dot like cytoplasmic positivity in cells in tubules and cells in glomeruli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC85B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ARQWQLFGTQASRAVREDLGGCWQKLAELEGRQEELLRE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC85B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CCDC85B Protein (NBP2-14457PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC85B Antibody

  • coiled-coil domain containing 85B
  • coiled-coil domain-containing protein 85B
  • DIPADelta-interacting protein A
  • hepatitis delta antigen interacting protein A
  • Hepatitis delta antigen-interacting protein A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81615
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-14970
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88822
Species: Hu
Applications: IHC, IHC-P
NBP1-59109
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for CCDC85B Antibody (NBP2-14457) (0)

There are no publications for CCDC85B Antibody (NBP2-14457).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC85B Antibody (NBP2-14457) (0)

There are no reviews for CCDC85B Antibody (NBP2-14457). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCDC85B Antibody (NBP2-14457) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC85B Products

CCDC85B NBP2-14457

Bioinformatics Tool for CCDC85B Antibody (NBP2-14457)

Discover related pathways, diseases and genes to CCDC85B Antibody (NBP2-14457). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC85B Antibody (NBP2-14457)

Discover more about diseases related to CCDC85B Antibody (NBP2-14457).
 

Pathways for CCDC85B Antibody (NBP2-14457)

View related products by pathway.

Blogs on CCDC85B

There are no specific blogs for CCDC85B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC85B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC85B