Cbx8 Antibody - BSA Free

Immunohistochemistry: Cbx8 Antibody [NBP3-38232] - Immunohistochemistry analysis of paraffin-embedded Human colon using Cbx8 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: Cbx8 Antibody [NBP3-38232] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using Cbx8 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: Cbx8 Antibody [NBP3-38232] - Immunohistochemistry analysis of paraffin-embedded Rat pancreas using Cbx8 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: Cbx8 Antibody [NBP3-38232] - Western blot analysis of various lysates using Cbx8 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cbx8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cbx8 Antibody - BSA Free (NBP3-38232) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-280 of human Cbx8 (NP_065700.1).
  
  Sequence:
  LLKAQAKAKAKTYEFRSDSARGIRIPYPGRSPQDLASTSRAREGLRNMGLSPPASSTSTSSTCRAEAPRDRDRDRDRDRERDRERERERERERERERERERGTSRVDDKPSSPGDSSKKRGPKPRKELPDPSQRPLGEPSAGLGEYLKGRKLDDTPSGAGKFPAGHSVIQLARRQDSDLVQCGVTSPSSAEATGKLAVDTF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CBX8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 43 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cbx8 Antibody - BSA Free

• chromobox homolog 8 (Drosophila Pc class)
• chromobox homolog 8 (Pc class homolog, Drosophila)
• chromobox homolog 8
• HPC3
• Pc3
• PC3chromobox protein homolog 8
• Polycomb 3 homolog
• polycomb 3
• RC1Pc class 3 homolog
• Rectachrome 1

Background

CBX8 is involved in maintaining the transcriptionally repressive state of genes. It modifies chromatin, rendering it heritably changed in its expressibility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CBX8