Cathepsin S Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Cathepsin S Antibody [NBP1-85807] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Cathepsin S Antibody [NBP1-85807] -Staining of human lymph node shows strong cytoplasmic granular positivity in a subset of non-germinal center cells.and germinal center cells

Immunohistochemistry-Paraffin: Cathepsin S Antibody [NBP1-85807] -Staining of human colon shows strong cytoplasmic granular positivity in glandular cells.

Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1, using Anti-CTSS antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Staining of human fallopian tube shows strong cytoplasmic granular positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cathepsin S Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cathepsin S Antibody - BSA Free (NBP1-85807) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Cathepsin S Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CTSS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Cathepsin S Protein (NBP1-85807PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cathepsin S Antibody - BSA Free

• Cathepsin S
• CTSS
• EC 3.4.22
• EC 3.4.22.27
• FLJ50259
• MGC3886

Background

Cathepsin S is encoded by this gene, a member of the peptidase C1 family, is a lysosomal cysteine proteinase that may participate in the degradation of antigenic proteins to peptides for presentation on MHC class II molecules. The encoded protein can function as an elastase over a broad pH range in alveolar macrophages. Transcript variants utilizing alternative polyadenylation signals exist for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cathepsin S Antibody (NBP1-85807)(2)

Publications using NBP1-85807

• Rushika M. Perera, Svetlana Stoykova, Brandon N. Nicolay et al. Transcriptional control of autophagy-lysosome function drives pancreatic cancer metabolism. Nature 2015-07-13 [PMID: 26168401] (IF/IHC, Human)
• Ma Y, Visser L, Roelofsen H et al. Proteomics analysis of Hodgkin lymphoma: identification of new players involved in the cross-talk between HRS cells and infiltrating lymphocytes. Blood 2008-02-01 [PMID: 18070985]

Bioinformatics

• Gene Symbol: CTSS
• Entrez:
  • 1520(Human)
• Uniprot:
  • P25774()