Novus Biologicals products are now on bio-techne.com

Cathepsin K Antibody

Images

 
Western Blot: Cathepsin K Antibody [NBP1-79878] - Human Fetal liver Cell Lysate, concentration 1 ug/ml.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Cathepsin K Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the middle region of human CTSK. Peptide sequence SPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMY. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTSK
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for Cathepsin K Antibody

  • cathepsin K (pycnodysostosis)
  • Cathepsin K
  • Cathepsin O
  • cathepsin O1
  • Cathepsin O2
  • Cathepsin X
  • CTS02
  • CTSK
  • CTSO
  • CTSO1
  • CTSO2
  • EC 3.4.22
  • EC 3.4.22.38
  • MGC23107
  • PKND
  • PYCD

Background

Cathepsin K is encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein, which is a member of the peptidase C1 protein family, is predominantly expressed in osteoclasts. However, the encoded protein is also expressed in a significant fraction of human breast cancers, where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis, an autosomal recessive disease characterized by osteosclerosis and short stature. This gene may be subject to RNA editing. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

462-TR/CF
Species: Mu
Applications: BA
AF952
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NB100-56508
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P, WB
DY805
Species: Hu
Applications: ELISA
H00000054-D01P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
DCDL40
Species: Hu
Applications: ELISA
NB100-56173
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
AF965
Species: Mu
Applications: IHC, Neut, WB
DMP900
Species: Hu
Applications: ELISA
AF1183
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, Neut, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-56732
Species: Hu, Mu
Applications: ICC/IF, IHC, Simple Western, WB
MAB4614
Species: Hu
Applications: CyTOF-ready, Flow, KO
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
M6000B
Species: Mu
Applications: ELISA

Publications for Cathepsin K Antibody (NBP1-79878) (0)

There are no publications for Cathepsin K Antibody (NBP1-79878).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin K Antibody (NBP1-79878) (0)

There are no reviews for Cathepsin K Antibody (NBP1-79878). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cathepsin K Antibody (NBP1-79878) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cathepsin K Products

Research Areas for Cathepsin K Antibody (NBP1-79878)

Find related products by research area.

Blogs on Cathepsin K

There are no specific blogs for Cathepsin K, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cathepsin K Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSK
Uniprot