Caspase-3 Antibody (7T1W5) - Active, Pro

Images

 
Western Blot: Caspase-3 Antibody (1U1D9) - Active, Pro [NBP3-15840] - Western blot analysis of extracts of various cell lines, using Caspase-3 antibody (NBP3-15840) at 1:1000 dilution. Secondary antibody: HRP Goat ...read more
Western Blot: Caspase-3 Antibody (7T1W5) - Active, Pro [Caspase-3] - Western blot analysis of lysates from Jurkat cells, using [KO Validated] active + pro Caspase-3 Rabbit mAb at 1:1000 dilution. Jurkat cells were ...read more
Western Blot: Caspase-3 Antibody (7T1W5) - Active, Pro [Caspase-3] - Western blot analysis of lysates from NIH/3T3 cells using Caspase-3 Rabbit mAb at 1:1000 dilution incubated overnight at 4C. NIH/3T3 cells were ...read more
Western Blot: Caspase-3 Antibody (7T1W5) - Active, Pro [Caspase-3] - Western blot analysis of lysates from L929 cells, using [KO Validated] active + pro Caspase-3 Rabbit mAb at 1:1000 dilution. L929 cells were treated ...read more
Genetic Strategies: Western Blot: Caspase-3 Antibody (7T1W5) - Active, Pro [Caspase-3] - Western blot analysis of lysates from wild type (WT) and Caspase-3 knockout (KO) 293T cells using [KO Validated] Caspase-3 ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, KO
Clone
7T1W5
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Caspase-3 Antibody (7T1W5) - Active, Pro Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 29-175 of human Caspase-3 (P42574). SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
Source
HEK293
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
CASP3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Knockout Validated
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.05% Proclin 300
Purity
Affinity purified

Alternate Names for Caspase-3 Antibody (7T1W5) - Active, Pro

  • Apopain
  • apoptosis-related cysteine protease
  • CASP3
  • CASP-3
  • caspase 3, apoptosis-related cysteine peptidase
  • Caspase3
  • Caspase-3
  • CPP32
  • CPP-32
  • CPP32B
  • CPP32SREBP cleavage activity 1
  • Cysteine protease CPP32
  • EC 3.4.22
  • EC 3.4.22.56
  • LICE-1
  • PARP cleavage protease
  • procaspase3
  • Protein Yama
  • SCA-1
  • YAMA

Background

CPP32 encodes a member of the cysteine-aspartic acid protease (caspase) family that plays a key role in apoptosis. Caspase 3 (also known as CPP32, Apopain, Yama, and PARP cleavage protease) is the most extensively studied apoptotic protein among caspase family members (1-2). Caspase 3 is synthesized as an inactive proenzyme that is processed in cells undergoing apoptosis by self-proteolysis and/or cleavage by other upstream proteases (e.g. Caspases 8, 9 and 10). Alternative splicing of CPP32 results in two transcript variants which encode the same protein. The processed form of Caspase 3 consists of large (theoretical molecular weight 17kD) and small (theoretical molecular weight 12kD) subunits which associate to form an active enzyme. Caspase 3 is cleaved at Asp28/Ser29 and Asp175/Ser176. The active Caspase 3 proteolytically cleaves and activates other caspases (e.g. Caspases 6, 7 and 9), as well as relevant targets in the cells (e.g. PARP and DFF). Variations in levels of Caspase 3 have been reported in cells of short-lived nature and those with a longer life cycle. Caspase 3 is the predominant caspase involved in the cleavage of amyloid beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease (3).

References

1.Mu, N., Lei, Y., Wang, Y., Wang, Y., Duan, Q., Ma, G., . . . Su, L. (2019). Inhibition of SIRT1/2 upregulates HSPA5 acetylation and induces pro-survival autophagy via ATF4-DDIT4-mTORC1 axis in human lung cancer cells. Apoptosis, 24(9-10), 798-811. doi:10.1007/s10495-019-01559-3

2.Sun, C. M., Enkhjargal, B., Reis, C., Zhou, K. R., Xie, Z. Y., Wu, L. Y., . . . Zhang, J. H. (2019). Osteopontin attenuates early brain injury through regulating autophagy-apoptosis interaction after subarachnoid hemorrhage in rats. CNS Neurosci Ther, 25(10), 1162-1172. doi:10.1111/cns.13199

3.Louneva, N., Cohen, J. W., Han, L. Y., Talbot, K., Wilson, R. S., Bennett, D. A., . . . Arnold, S. E. (2008). Caspase-3 is enriched in postsynaptic densities and increased in Alzheimer's disease. Am J Pathol, 173(5), 1488-1495. doi:10.2353/ajpath.2008.080434

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP2-43728
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
7398-FS
Species: Hu
Applications: BA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP3-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, KO

Publications for Caspase-3 Antibody (NBP3-15840) (0)

There are no publications for Caspase-3 Antibody (NBP3-15840).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caspase-3 Antibody (NBP3-15840) (0)

There are no reviews for Caspase-3 Antibody (NBP3-15840). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Caspase-3 Antibody (NBP3-15840) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Caspase-3 Products

Research Areas for Caspase-3 Antibody (NBP3-15840)

Find related products by research area.

Blogs on Caspase-3. Showing 1-10 of 11 blog posts - Show all blog posts.

Pyroptosis: Mechanisms mediating cell death and pro-inflammatory cytokine release
By Victoria OsinskiPyroptosis is an inflammatory form of programmed cell death characterized by the release of pro-inflammatory cytokines IL-1 beta and IL-18.1,10 It is a process distinct from apoptosis and necrosis (T...  Read full blog post.

COVID-19 and metabolic dysregulation: SARS-CoV-2 injures human exocrine and endocrine pancreas
Jamshed Arslan, Pharm D, PhD Humans rely on the pancreas for digesting food and generating energy from it. SARS-CoV-2-mediated damage to the exocrine pancreas is evident from the pancreatitis, pancreatic enlargeme...  Read full blog post.


  Read full blog post.

The Ins and Outs of Survivin
By Rachel M.A. Linger, Ph.D.What is survivin?Survivin is a small (16.5 kDa) protein normally found in human fetal tissue. In contrast, survivin is typically undetectable in most normal adult tissues. Expression of ...  Read full blog post.

Cleaved Caspase-3: A Marker of Programmed Cell Death
What are Caspases?Caspases, or cysteine-dependent aspartate specific proteases, are a family of enzymes crucial for initiating and executing apoptosis within a cell, an important biological event especially during organ development (1). Environme...  Read full blog post.

Caspase-3, The Executioner of Apoptosis
The Role of Caspase-3 in ApoptosisCaspase-3 enzyme is a member of the family of endoproteases which regulate inflammation and apoptosis signaling networks. Caspase-3 is known as an executioner caspase in apoptosis because of its role in coordinat...  Read full blog post.

Caspase 7 - A key effector of the apoptotic pathway
Caspase-7 is an effector caspase with important roles in mediating cell death signaling. As an effector caspase, caspase-7 is cleaved and activated by initiator caspases such as caspase-1 (1). Like other caspase family proteins, caspase-7 contains a...  Read full blog post.

Caspase 11 - A proinflammatory caspase that induces the innate immune response
While known for their role in programmed cell death, caspases are also essential for mediating inflammatory responses and innate immunity. Binding of microbial molecules by pattern recognition receptors triggers the formation of the multiprotein in...  Read full blog post.

LC3/LC3B - measuring autophagosome formation and autophagic flux
Microtubule-associated protein-1 light chain 3 (LC3/LC3B) is a ubiquitin-like protein involved in the formation of the autophagosome. It is homologous to the yeast Atg8 protein. Autophagosomes are important for the degradation and recycling of intr...  Read full blog post.

D4-GDI (GDP dissociation inhibitor, RhoGD12)
The D4-GDI protein is a negative regulator of the Ras-related Rho family of small molecule "molecular switch" GTPases. The Rho GTPases modify cell structure and architecture via rapid changes to the actin cytoskeleton and cell membrane. M...  Read full blog post.

Showing 1-10 of 11 blog posts - Show all blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Caspase-3 Antibody (7T1W5) - Active, Pro and receive a gift card or discount.

Bioinformatics

Gene Symbol CASP3