Carboxylesterase 3/CES3/Esterase 31 Antibody


Immunohistochemistry: Carboxylesterase 3/CES3/Esterase 31 Antibody [NBP2-48728] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Carboxylesterase 3/CES3/Esterase 31 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PVLTSLDVPPEMMPTVIDEYLGSNSDAQAKCQAFQEFMGDVFINVPTVSFSRYLRDSGSPVFFYEFQHRPSSF
Specificity of human Carboxylesterase 3/CES3/Esterase 31 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Carboxylesterase 3/CES3/Esterase 31 Recombinant Protein Antigen (NBP2-48728PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Carboxylesterase 3/CES3/Esterase 31 Antibody

  • carboxylesterase 3 (brain)
  • Carboxylesterase 3
  • CES3
  • EC 3.1.1
  • EC
  • ES31FLJ21736
  • esterase 31
  • Liver carboxylesterase 31 homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, ICC
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Rb, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Carboxylesterase 3/CES3/Esterase 31 Antibody (NBP2-48728) (0)

There are no publications for Carboxylesterase 3/CES3/Esterase 31 Antibody (NBP2-48728).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carboxylesterase 3/CES3/Esterase 31 Antibody (NBP2-48728) (0)

There are no reviews for Carboxylesterase 3/CES3/Esterase 31 Antibody (NBP2-48728). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Carboxylesterase 3/CES3/Esterase 31 Antibody (NBP2-48728) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Carboxylesterase 3/CES3/Esterase 31 Products

Bioinformatics Tool for Carboxylesterase 3/CES3/Esterase 31 Antibody (NBP2-48728)

Discover related pathways, diseases and genes to Carboxylesterase 3/CES3/Esterase 31 Antibody (NBP2-48728). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carboxylesterase 3/CES3/Esterase 31 Antibody (NBP2-48728)

Discover more about diseases related to Carboxylesterase 3/CES3/Esterase 31 Antibody (NBP2-48728).

Pathways for Carboxylesterase 3/CES3/Esterase 31 Antibody (NBP2-48728)

View related products by pathway.

PTMs for Carboxylesterase 3/CES3/Esterase 31 Antibody (NBP2-48728)

Learn more about PTMs related to Carboxylesterase 3/CES3/Esterase 31 Antibody (NBP2-48728).

Blogs on Carboxylesterase 3/CES3/Esterase 31

There are no specific blogs for Carboxylesterase 3/CES3/Esterase 31, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Carboxylesterase 3/CES3/Esterase 31 Antibody and receive a gift card or discount.


Gene Symbol CES3